Anti-Kv1.2



Product#:APC-010

Sizes:
50 µl
0.2 ml


KV1.2 is a mammalian voltage dependent K+ channel, homologous to the Drosophilae Shaker K+ channel. KV1.2 was first cloned from rat brain.1 Eight Shaker related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes.2

A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.

The structure of KV1.2 channel is similar to all KV channels and includes six membrane spanning helixes creating a voltage sensor domain and a pore domain. 2

The channel is expressed in neurons and cardiac and smooth muscle tissue as well as in retina and pancreas.2 The crystal structure of KV1.2 was recently solved shading light on the structure of a mammalian voltage dependent channel.3 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.

KV1.2 channels are sensitive to high doses of TEA (560 mM) and low doses of 4-AP (0.59 mM), the “classical” non-selective potassium channel blockers.

Several venomous toxins from Snakes, Scorpions and Honey Bee are potent blockers (affecting the channels in the nanomolar range) of KV1.2 channels. Among these the most potent and selective are a-Dendrotoxin (D-350, 1-12nM), Dendrotoxin-I (D-390, 0.13nM), Maurotoxin (RTM-340, 0.1-0.8nM), Hongotoxin-1 (RTH-400, 0.17nM), Margatoxin (RTM-325, 0.16-0.65nM), Tityustoxin Ka (RTT-360, 0.21nM) and MCD peptide (M-250, 10-400nM). 4



Host:

Rabbit.

Type:
Polyclonal.

Epitope:

GST fusion protein with sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat Kv1.2 (Accession P15386).

Putative epitope location:

Intracellular, C-terminus.

Homology:

Mouse, dog, human, - identical.

Reactivity Confirmed:
Rat.
Applications:
Western Blotting:
 

Western blot analysis of rat brain membranes:

1. Anti-Kv1.2 antibody (#APC-010), (1:200).

2. Anti-Kv1.2 antibody, preincubated with the control peptide antigen.

 

 

Western blot analysis of rat heart membranes:

1. Anti-Kv1.2 antibody (#APC-010), (1:200)

2. Anti-Kv1.2 antibody, preincubated with the control antigen.

Immunohistochemistry:

Rat brain sections


References:
1. McKinnon, D. (1989) J.Biol. Chem. 264, 8230.
2. Gutman, G. A. et al. (2005) Pharmacol. Rev. 57, 473.
3. Long S. B., et al. (2005) Science 309, 897.
4. Bogin, O (2006) Modulator 21, 28. http://www.alomone.com/System/UpLoadFiles/DGallery/Docs/venom_toxins.pdf

For research purposes only, not for human use.