Anti-Kv1.4



Product#:APC-007

Sizes:
50 µl
0.2 ml


KV1.4 is a mammalian voltage dependent K+ channel, homologous to the Drosophilae Shaker K+ channel. KV1.4 was first cloned from rat brain.1 Eight Shaker related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes.2

A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.

The structure of KV1.4 channel is similar to all KV channels and includes six membrane spanning helixes creating a voltage sensor domain and a pore domain. 2

The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in pancreas.2 The functional channel is considered transient (A-type) current and shows pronounced inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.

KV1.4 channels are sensitive to high doses of TEA (>100 mM) and low doses of 4-AP (0.013 mM), the “classical” non-selective potassium channel blockers.

Most venomous peptide toxins that affect other KV channels do not inhibit KV1.4. However, the sea anemone toxin  rStichodactyla Toxin (ShK) (#S-400), which is more potent towards KV1.1 and KV1.3 is still a potent inhibitor of KV1.4 channels.3



Host:

Rabbit.


Type:
Polyclonal.

 

Epitope:

GST fusion protein with sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEE GVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat  Kv1.4 (Accession P15385).

Putative epitope location:

Intracellular, C-terminus.

Homology:

Mouse - identical; human - 66/67 (or 65/67) amino acid residues identical; bovine - 64/67 amino acid residues identical.

Reactivity Confirmed:
Rat.
Applications:
Western Blotting:
 

Western blot analysis of rat brain membranes:

1. Anti-Kv1.4 antibody (#APC-007), (1:200).

2. Anti-Kv1.4 antibody, preincubated with the control peptide antigen.


References:
1. Stuhmer, W., et al. (1989) EMBO J. 8, 3235.
2. Gutman, G. A. et al. (2005) Pharmacol. Rev. 57, 473.
3. Bogin, O (2006) Modulator 21, 28. http://www.alomone.com/System/UpLoadFiles/DGallery/Docs/venom_toxins.pdf

For research purposes only, not for human use.