Anti-Kv1.6



Product#:APC-003

Sizes:
50 µl
0.2 ml


KV1.6 is a mammalian voltage dependent K+ channel, homologous to the Drosophilae Shaker K+ channel. KV1.6 was first cloned from human brain.1 Eight Shaker related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes.2

A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.

The structure of KV1.6 channel is similar to all KV channels and includes six membrane spanning helixes creating a voltage sensor domain and a pore domain. 2

The channel is expressed in neurons and other supporting cells in the brain, in cardiac and smooth muscle tissue as well as in ovary and testis2 and its activity influences the membrane potential and excitability of expressing cells.

 

KV1.6 channels are sensitive to low doses of TEA (7 mM) and high doses of 4-AP (1.5 mM), the “classical” non-selective potassium channel blockers.

 

Several toxins from snakes, scorpions and sea anemones venoms are potent blockers (affecting the channels in the nanomolar range) of KV1.6 channels. Among these the most potent and selective are a-Dendrotoxin (#D-350), (9-25nM) and d-Dendrotoxin (#D-380), (23nM), rAgitoxin-2 (#RTA-420), (0.036nM)  rHongotoxin-1 (#RTH-400), (6nM), rMargatoxin (#RTM-325), (5nM) and rStichodactyla Toxin (#RTS-400), (0.16mM).3



Host:

Rabbit.

Type:
Polyclonal.

Epitope:

GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKA TDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 of rat Kv1.6 (Accession P17659).

Putative epitope location:
Intracellular, C-terminus.
Homology:

Mouse - 67/68 amino acid residues identical; human - 63/68 amino acid residues identical.

Reactivity Confirmed:
Rat.
Applications:
Western Blotting:
 

Western blot analysis of rat brain membranes:

1. Anti-Kv1.6 antibody (#APC-003), (1:200).

2. Anti-Kv1.6 antibody, preincubated with the control peptide antigen.

Immunohistochemistry:
Rat brain sections.

References:
1. Grupe, A. et al. (1990) EMBO J. 9, 1749.
2. Gutman, G. A. et al. (2005) Pharmacol. Rev. 57, 473.
3. Bogin, O (2006) Modulator 21, 28. http://www.alomone.com/System/UpLoadFiles/DGallery/Docs/venom_toxins.pdf

For research purposes only, not for human use.