Anti-Kir1.1 (ROMK1)



Product#:APC-001

Sizes:
50 ml
0.2 ml


Kir1.1 (ROMK1) was the first member of the family of inward rectifying K+ channels to be cloned.1 The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels.

 

The family’s topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N- and C-termini. As is the case for the voltage-dependent K+ channels the functional unit for the Kir channels is composed of four subunits that can assembly as either homo or heterotetramers.

 

Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus making them essential for controlling resting membrane potential and K+ homeostasis.3

As its original name indicates (ROMK1 stands for Renal Outer Medullary K+ channel) Kir1.1 is strongly expressed in the kidney in the apical membrane of several kidney segments such as the thick ascending loop of Henle (TAL) and the cortical collecting duct (CCD). In addition, the channel is also expressed in the brain mainly in the cortex and hippocampus.3

 

Kir1.1 plays a key role in K+ recycling in the loop of Henle. Indeed, loss of function mutations in the Kir1.1 gene cause Bartter’s syndrome type II, a recessive autosomal disease characterized by the impairment of K+ efflux and the subsequent inability of the NKCC2 transporter to continue NaCl uptake. This leads to a high salt concentration in the urine that induces osmotic diuresis and low plasma volume.2

 

Pharmacologically, the Kir1.1 channel can be inhibited by several general K+ channel blockers such as Tertiapin (#RTT-250), however the scorpion toxin Lq2 (#RTL-550) specifically and potently inhibits Kir1.1 channels.4 



Epitope:

GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat ROMK1 (Accession P35560).

Putative epitope location:

Intracellular, C-terminus.

Homology:

Mouse - identical, human - 45/50 residues identical.

Reactivity Confirmed:
Rat, mouse.
Applications:
Western Blotting:
 
Western blotting of rat kidney membranes:
1. Anti-Kir1.1 (#APC-001) (1:200).
2. Anti-Kir1.1, preincubated with the control antigen.
Immunohistochemistry:
Expression of Kir1.1 in Rat Kidney
Immunohistochemical staining of Kir1.1 in rat kidney.  Rat kidney sections were incubated with Anti-Kir1.1 antibody (#APC-001) (left).  There is stong staining (red) of tubular epithelial cells in distal tubes.  Note that no staining is observed in proximal tubules (arrow).  Counterstain of cell nuclei appears blue.  A negative control is shown (right).

References:
1. Ho, K. et al. (1993) Nature 362, 31.
2. Simon, D.B. et al. (1996) Nat. Genet. 14, 152.
3. Wang, W-H. (2006) Am. J. Physiol. Renal Physiol. 290, F14.
4. Lu, Z. and McKinnon, R. (1997) Biochemistry 36, 6936.

For research purposes only, not for human use.