Anti-Kv1.5-ATTO-550



Product#:APC-004-AO

Sizes:
50 µl


KV1.5 is a mammalian voltage dependent K+ channel, homologous to the Drosophilae Shaker K+ channel. KV1.5 was first cloned from rat brain.1 Eight Shaker related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes.2

A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.

The structure of KV1.5 channel is similar to all KV channels and includes six membrane spanning helixes creating a voltage sensor domain and a pore domain. 2

The channel is expressed in cardiac and smooth muscle tissue (Colon, Aorta, Stomach and Pulmonary artery) as well as in neurons and kidney.2 A loss of function mutation in the gene encoding the channel was found in atrial fibrilation patients, stressing its role as a cardiac action potential regulator.3

 

The functional channel is considered transient (A-type) channel and shows prominent inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.

 

KV1.5 channels are sensitive to high doses of TEA (330 mM) and low doses of 4-AP (0.27 mM), the “classical” non-selective potassium channel blockers.2

 

Alomone Labs offers a highly specific antibody directed against an epitope situated in the intracellular C-terminus of the mouse Kv1.5 channel. The Anti-Kv1.5 antibody (#APC-004) can be used in immunohistochemical and Western blot applications and recognizes Kv1.5 from rat, mouse, and human samples.

 

Alomone Labs is pleased to offer a new version of this antibody that is directly labeled with an ATTO-550 fluorescent dye. ATTO dyes are characterized by strong absorption (high extinction coefficient), high fluorescence quantum yield, and high photo-stability. The ATTO-550 fluorescent label is related to the well known dye Rhodamine 6G and can be used with filters typically used to detect Rhodamine.

 

The Anti-Kv1.5-ATTO-550 antibody (#APC-004-AO) has been tested in immunohistochemical applications and is specially suited for experiments requiring simultaneous labeling of different markers.



Host:

Rabbit.

Type:
Polyclonal. 

Epitope:

GST fusion protein with sequence HRETDHEEQAALKEEQGIQRRESGLDTGGQ RKVSCSKASFHKTGGPLESTDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTS RETDL,corresponding to amino acid residues 513-602 of mouse Kv1.5 (Accession Q61762).

Putative epitope location:

Intracellular, C-terminus.

Homology:

Rat - 86/90 amino acid residues identical; rabbit - 71/90 amino acid residues identical; human - 70/90 amino acid residues identical; bovine, dog - 66/90 amino acid residues identical.

 

Label:

ATTO-550. Maximum absorption 554 nm; maximum fluorescence 576 nm. The fluorescence is excited most efficiently in the 540 - 565 nm range.

This label is related to the well known dye Rhodamine 6G and can be used with filters typically used to detect Rhodamine.

Reactivity Confirmed:
Rat, mouse.

Standard Quality Control of each lot:
Western blot analysis (unlabeled antibody, see datasheet of product (#APC-004) and immunohistochemistry (labeled antibody).
Applications:
Immunohistochemistry:
Expression of Kv1.5 in mouse cerebellum 

Immunohistochemical staining of perfusion fixed, free-floating frozen mouse brain sections using Anti-Kv1.5-ATTO-550 (#APC-004-AO), (1:50), (red). Staining was detected in cerebellar Bergmann glial cells (white arrows). DAPI is used as the counterstain (blue). G = granule layer, P = Purkinje layer, M = molecular layer.

 

Expression of Kv1.5 in rat cerebellum

Immunohistochemical staining of perfusion fixed, free-floating frozen rat brain sections using Anti-Kv1.5-ATTO-550 (#APC-004-AO), (1:50), (red). Staining was detected in cerebellar Bergmann glial cells (white arrows). DAPI is used as the counterstain (blue). G = granule layer, P = Purkinje layer, M = molecular layer.


References:
1. Swanson, R. et al. (1990) Neuron 4, 929.
2. Gutman, G. A. et al. (2005) Pharmacol. Rev. 57, 473.
3. McGahon, M. K. et al. (2007) Am. J. Physiol. Heart Circ. Physiol. 292, H1001.

For research purposes only, not for human use.