Anti-hKv11.1 (HERG)



Product#:APC-062

Sizes:
50 ml
0.2 ml


The KV11.1 (HERG) channel is a member of the ether-a-go-go (EAG) subfamily of voltage-dependent K+ channels that includes the related proteins KV11.2 and KV11.3 (erg2 and erg3). KV11.1 possess the signature structure of the voltage-dependent K+ channels: six membrane-spanning domains and intracellular N and C termini.

The KV11.1 current is characterized by strong inward rectification with slow activation and very rapid inactivation kinetics. The channel is expressed in the brain and heart (where it underlies the IKr current) and has a central role in mediating repolarization of action potentials.1,2

Mutations in the KV11.1 channel cause inherited long QT syndrome (LQTS) or abnormalities in the repolarization of the heart that are associated with life-threatening arrhythmias and sudden death. All the identified KV11.1 mutations produce loss of function of the channel via several cellular mechanisms ranging from alterations of gating properties, alterations of channel permeability/selectivity and alterations in intracellular channel trafficking that decreases the number of channels that reach the cell membrane.1,2 

Lately drug-induced forms of LQTS have been reported for a wide range of non-cardiac drugs including antihistamines, psychoactive agents and antimicrobials. All these drugs potently block the KV11.1 channel as an unintended side effect, prompting regulatory drug agencies to issue recommendations for the testing of new drugs for their potential KV11.1 blocking effect.

 

In addition, KV11.1 expression was found to be upregulated in several tumor cell lines of different histogenesis suggesting that it confers the cells some advantage in cell proliferation. Indeed, in several studies it has been shown that inhibition of the KV11.1 current leads to a decrease in tumor cell proliferation.3

 

Several toxins from scorpion venoms are potent blockers (affecting the channels in the nanomolar range) of KV11.1channels. Among these the most potent and selective are Ergtoxin-1 (#RTE-450), (16nM)4 and BeKM-1 (#RTB-470), (3nM).5 In addition, the methanesulfonanilide class III antiarrhythmic agent E-4031 (#E-500), also blocks KV11.1 channel in the nanomolar range (7.7nM).6

 

Alomone Labs is pleased to offer a highly specific antibody directed against an intracellular epitope of human Kv11.1. The Anti-hKv11.1 (HERG) antibody (#APC-062) can be used for western blot, immunoprecipitation and immunocytochemical applications.



Host:

Rabbit.

Type:
Polyclonal.

Epitope:

GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRR LSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human Kv11.1 (HERG) (Accession Q12809).

Putative epitope location:

Intracellular, C-terminus.

Homology:

Rabbit - identical; dog - 51/54 amino acid residues identical; mouse, rat - 50/54 amino acid residues identical.

Reactivity Confirmed:
Human.
Applications:
Western Blotting:
 
Western blot analysis of Kv11.1 expressing HEK-293 cells:
1. Anti-hKv11.1 (HERG) antibody (#APC-062), (1:400).
2. Anti-hKv11.1 (HERG) antibody, preincubated with the control peptide antigen.
Immunocytochemistry:
Expression of Kv11.1 in HEK-293 transfected cells 
Immunocytochemical staining of fixed and permeabilized Kv11.1 transfected HEK-293 cells. 

Cells were stained with Anti-hKv11.1 (HERG) antibody (#APC-062), followed by goat anti-rabbit-AlexaFluor-555 secondary antibody (Red). Almost all transfected cells are stained positive for the Kv11.1. Arrows indicate cells that do not express the channel.

Immunoprecipitation:
 

Immunoprecipitation of Kv11.1 expressing HEK-293 cells:

1. Cell lysate.

2. Lysate + protein A beads + Anti- hKv11.1 (HERG) antibody (#APC-062).

3. Cell lysate + protein A beads + Anti-Kv11.1 (erg1) antibody (#APC-016).

4. Cell lysate + protein A beads + Anti-Kv11.1 (HERG) (extracellular) antibody (#APC-109).

5. Cell lysate + protein A beads + pre-immune rabbit serum.


Red arrow indicates Kv11.1 while the black arrow shows the IgG heavy chain.

Immunoblot was performed with the Anti- hKv11.1 (HERG) antibody.

References:
1. Curran, M.E. et al. (1995) Cell 80, 795.
2. Sanguinetti, M.C. et al. (1995) Cell 81, 299.
3. Pardo, L.A. et al. (2004) Physiology 19, 285.
4. Gurrola, G.B. et al. (1999) FASEB. J. 13, 953. 
5. Korolkova, Y.V. et al. (2001) J. Biol. Chem. 276, 9868.
6. Zhou, Z. et al. (1998) Biophys.J. 74, 230.

For research purposes only, not for human use.