Anti-KCNE1 (IsK)

Product#:

APC-008

Sizes:

50 ml

0.2 ml

In 1999, three gene families that encode minK-related peptides (MiRPs) were identified (known also as IsK-related auxiliary subunits). These MiRPs, along with minK, constitute four KCNE families (KCNE1 to KCNE4, encoding minK and MiRP1 to MiRP3).¹MiRP1 mutations that are linked to congenital (LQT6) or acquired LQT syndrome have been identified. However, currently there is no biochemical evidence supporting an association between native MiRP1 and hERG proteins in cardiac myocytes.² MiRP2 has been shown to decrease the single channel conductance and accelerates the rate of HERG channel deactivation³ and to suppress the expression of hERG in oocytes.

Host:

Rabbit.

Epitope:

GST fusion protein with a sequence RSKKLEHSNDPFNVY IESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETK PSP, corresponding to residues 67-129 of human KCNE1 (IsK) (Accession P15382).

Putative epitope location:

Intracellular, C-terminus.

Homology:

Cat, mouse, rat, rabbit, pig, guinea pig - respectively, 50/61, 49/61, 49/61, 47/62, 48/6/, and 46/58 residues identical.

Reactivity Confirmed:

Rat, human.

Applications:

Western Blotting:

Western blotting of rat heart membranes
1. Anti-KCNE1 (IsK) antibody, 1:200.
2. Anti-KCNE1, preincubated with the control fusion protein.

Western blotting of KCNE1 (IsK) expressing Sf9 cells.
1. Anti-KCNE1 (IsK) antibody, 1:200.
2. Anti-KCNE1, preincubated with the control fusion protein.

References:

1. Abbott, G.W. et al. (1999) Cell 97, 175.

2. Pardo-Lopez L. et al. (2002) J. Biol. Chem 227, 16403.

3. Shieh, C.C. et al. (2000) Pharmacol. Rev. 52, 557.

For research purposes only, not for human use.