Free shipping starts now, no minimum, no coupons required!
Home › Products › Ion Channels › Breast Cancer › Blockers

Aa1 Toxin

K+ channel toxin α-KTx 15.4, AaTX1

A Novel Blocker of Shaker-B and IA K+ Channels

Cat #: RTA-400
Alternative Name K+ channel toxin α-KTx 15.4, AaTX1
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Recombinant, E. coli
    MW: 3868 Da
    Purity: >98% (HPLC)
    Effective concentration 100 nM - 1 µM.
    Sequence QNETNKKCQGGSCASVCRRVIGVAAGKCINGRCVCYP.
    Modifications Disulfide bonds between Cys8-Cys28, Cys13-Cys33, and Cys17-Cys35.
    Structure
    Molecular formula C156H266N54O49S6.
    Activity Aa1 Toxin is a blocker of A-type voltage-gated transient K+ channels of cerebellar granular cells1,2.
    References-Activity
    1. Pisciotta, M. et al. (1998) Biochem. Biophys. Res. Comm. 242, 287.
    2. Pisciotta, M. et al. (1998) Eur. Biophys. J. 27, 69.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Aa1 Toxin inhibits Shaker-B channels expressed in Xenopus oocytes.
      Alomone Labs Aa1 Toxin inhibits Shaker-B channels expressed in Xenopus oocytes.
      Left: Current responses to 100 ms depolarization to 0 mV from holding potential of -100 mV, delivered every 10 seconds before (red) and during (green) application of 1 µM Aa1 Toxin (#RTA-400). Right: Time course of amplitude inhibition.
    References - Scientific background
    1. Pisciotta, M. et al. (1998) Biochem. Biophys. Res. Comm. 242, 287.
    2. Pisciotta, M. et al. (1998) Eur. Biophys. J. 27, 69.
    3. Pisciotta, M. et al. (2000) Biochim. Biophys. Acta. 1468, 203.
    Scientific background Native Aa1 was originally isolated from Androctonus australis scorpion venom. Aa1 blocks Shaker B channels expressed in Xenopus oocytes with IC50=4.5 µM.1 In addition, the Aa1 toxin was shown to block the fast (A-type) K+ current in cerebellum granular cells (IC 50 =134 nM,2 or Kd = 150 nM3). In both cases the block is non-voltage-dependent and does not affect kinetic parameters of the K+ currents.
    Target KV1.3 K+ channels
    Peptide Content: 100%
    Lyophilized Powder
    Last update: 06/11/2022

    Aa1 Toxin (#RTA-400) is a highly pure, recombinant, and biologically active peptide toxin.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Resources

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us