Agitoxin-1

K+ channel toxin α-KTx 3.4, Leiurotoxin-2, AgTx-1, AgTx1, Leiurotoxin II, LeTx II
A Potent Blocker of KV1.3 Channels
    Cat #: STA-150
    Alternative Name K+ channel toxin α-KTx 3.4, Leiurotoxin-2, AgTx-1, AgTx1, Leiurotoxin II, LeTx II
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 4015 Da.
    Purity: >98% (HPLC)
    Effective concentration <1 nM.
    Sequence GVPINVKCTGSPQCLKPCKDAGMRFGKCINGKCHCTPK.
    Modifications Disulfide bonds between Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35.
      • Agitoxin-1
    Molecular formula C169H278N52O47S7.
    CAS No.: 155646-21-2.
    Activity Agitoxin-1 is a blocker of Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
      • Agitoxin-1
        Alomone Labs Agitoxin-1 blocks KV1.3 channels expressed in Xenopus oocytes.
        A. Representative time course of Agitoxin-1 (#STA-150) inhibition of KV1.3 current. Membrane potential was held at -100 mV. Current elicited by a 100 ms voltage ramp to +60 mV every 10 sec was significantly and reversibly inhibited by 2 min applications of 0.5 nM and 5 nM Agitoxin-1, as indicated. B. Superimposed traces of KV1.3 current before and after application of 0.5 nM and 5 nM Agitoxin-1, taken from the recording in A.
    References - Scientific background
      • Like Agitoxin-2, Agitoxin-1 is a potent blocker of the Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker.1

    Target KV1.3 channels
    Net Peptide Content: 100%
    Last update: 17/11/2019

    Agitoxin-1 (#STA-150) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Citations
      • Meneses, D. et al. (2016) Neural Plast. 2016, 8782518.
      • Druzin, M. et al. (2011) PLoS ONE 6, e20213.
      • Al-Sabi, A. et al. (2010) J. Gen. Physiol. 136, 273.
    Related Products