Overview
Cat #:
STA-400
Alternative Name APE 2-1, AP-C, ApC, Delta-actitoxin-Ael1a, δ-actitoxin-Ael1a, Delta-AITX-Ael1a
Lyophilized Powder yes
Origin Anthopleura elegantissima (Green aggregating anemone) (Actinia elegantissima)
Source Synthetic Peptides
MW: 4878 Da
Purity: >98% (HPLC)
Form Lyophilized Powder
Effective concentration 1 - 50 nM
Sequence GVPCLCDSDGPSVRGNTLSGILWLAGCPSGWHNCKAHGPTIGWCCKQ
Modifications Disulfide bonds between Cys4-Cys44, Cys6-Cys34, and Cys27-Cys45
Structure
Molecular formula C210H316N62O61S6
Activity Anthopleurin-C is a potent cardiotoxin, which evokes a positive inotropic and chronotropic effect on mammalian heart muscle1,2. It also modifies the current passing through the fast Na+ channel in neuroblastoma cells, leading to delay and incomplete inactivation2.
References-Activity
- Norton, T.R. (1981) Federation Proc. 40, 21.
- Bruhn, T. et al. (2001) Toxicon 39, 693.
Accession number P01532
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Protect from light and moisture.
Solubility Soluble in DDW.
Centrifuge all products before use (10000 x, g 5 min). Avoid multiple freezing and thawing. It is recommended to prepare fresh solutions in working buffers before use, or aliquot stock solutions reconstituted in distilled water and keep at -20°C. Upon use, dilute the stock solution in the desired working buffer.
Centrifuge all products before use (10000 x, g 5 min). Avoid multiple freezing and thawing. It is recommended to prepare fresh solutions in working buffers before use, or aliquot stock solutions reconstituted in distilled water and keep at -20°C. Upon use, dilute the stock solution in the desired working buffer.
Storage of solutions Store up to one week at 4°C or up to 6 months at -20°C.
Our bioassay
- Alomone Labs Anthopleurin-C enhances NaV1.5 channel currents expressed in HEK cells.Representative superimposed traces of NaV1.5 currents in the absence (black) or presence (green) of 10 nM Anthopleurin-C (#STA-400). Currents were elicited by a 20 ms voltage step to -20 mV every 3 sec from a holding potential of -90 mV.
The figure was kindly provided by Prof. Shai Berlin, Ruth and Bruce Rappaport Faculty of Medicine, Technion, Israel.
References - Scientific background
- Norton, T.R. (1981) Federation Proc. 40, 21.
- Bruhn, T. et al. (2001) Toxicon 39, 693.
Scientific background
A potent cardiotoxin, which evokes a positive inotropic and chronotropic effect on mammalian heart muscle.1,2 This toxin was found to modify the current passing through the fast Na+ channel in neuroblastoma cells, leading to delay and incomplete inactivation.2
Effective at concentrations of 1-5 nM in isolated guinea-pig atria.2
Target NaV channels
Peptide Content: 100%
Lyophilized Powder
Anthopleurin-C (#STA-400) is a highly pure, natural, and biologically active peptide toxin.
For research purposes only, not for human use
Last Update: 02/01/2024
Applications
Citations
Citations