Free shipping starts now, no minimum, no coupons required!

Anti-CaV1.2a (CACNA1C) Antibody

Cardiac type α1C, Voltage-dependent L-type calcium channel subunit alpha-1C.

Cat #: ACC-013
Alternative Name Cardiac type α1C, Voltage-dependent L-type calcium channel subunit alpha-1C.
Lyophilized Powder yes
Type: Polyclonal
Host: Rabbit
Reactivity: h, m, r
  • GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine (Accession P15381). Intracellular, N-terminus.
Accession (Uniprot) Number P15381
Gene ID 100101555
Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
Homology Rat, guinea pig - 31/46 amino acid residues identical.
RRID AB_2039773.
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Isotype Rabbit IgG.
Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Reconstitution 25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody concentration after reconstitution 0.95 mg/ml.
Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Standard quality control of each lot Western blot analysis.
Applications: ic, if, ih, ip, wb
May also work in: ifc*
Western blot
  • Western blot analysis of rat heart membranes:
    Western blot analysis of rat heart membranes:
    1. Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013), (1:200).   
    2. Anti-CaV1.2a (CACNA1C) Antibody, preincubated with Cav1.2a/CACNA1C Blocking Peptide (#BLP-CC013).
  • Mouse brain homogenates (5 µg), (Garau, G. et al. (2015) Exp. Neurol. 274, 156.)
  • Expression of CaV1.2a in rat heart
    Expression of CaV1.2a in rat heart
    Immunohistochemical staining of rat heart with Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013). CaV1.2a was visualized with immuno-peroxidase methods and final brown-black diaminobenzidine color product (arrows in A). Cresyl violet is used as the counterstain. When the antibody was pre-incubated with the control peptide antigen, staining was blocked (B).
  • Human cardiac tissue (Crossman, D.J. et al. (2011) PLoS ONE 6, e17901.).
  • c-kit+ cells from mouse bone marrow (Lagostena, L. et al. (2005) Cardiovasc. Res. 66, 482.).
  1. Catterall, W.A. et al. (2003) Pharmacol. Rev. 55, 579.
  3. Hu, X.Q. et al. (1998) J. Biol. Chem. 273, 5337.
  4. Kreuzberg, U. et al. (2000) Am J. Physiol. 278, H723.
  5. Allard, B. et al. (2000) J. Biol. Chem. 275, 25556.
  6. Keef, K.D. et al. (2001) Am. J. Physiol. 281, C1743.
Scientific background

All L-type calcium channels are encoded by one of the CaV1 channel genes. These channels play a major role as a Ca2+ entry pathway in skeletal, cardiac and smooth muscles as well as in neurons, endocrine cells and possibly in non-excitable cells such as hematopoetic and epithelial cells. All CaV1 channels are influenced by dihydropyridines (DHP) and are also referred to as DHP receptors.

While the CaV1.1 and CaV1.4 isoforms are expressed in restricted tissues (skeletal muscle and retina, respectively), the expression of CaV1.2 is ubiquitous and CaV1.3 channels are found in the heart, brain and pancreas. Several peptidyl toxins are described that are specific L-type channel blockers, but so far no selective blocker for one of the CaV1 isoforms have been described. These include the Mamba toxins Calcicludine (#SPC-650), Calciseptine (#C-500) and FS-2 (#F-700).

There are two splice variants to the CaV1.2 channel designated CaV1.2a and CaV1.2b. The expression of the CaV1.2b variant is restricted to smooth muscle while CaV1.2a is specifically expressed in cardiac muscle.

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat
Image & Title:

Anti-Cav1.2a (CACNA1C) Antibody
Expression of CaV1.2 in human heart.Immunohistochemical staining of human heart sections using Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013). CaV1.2 staining (green) shows moderate co-localization with ryanodine receptor staining (red).Adapted from Crossman, D.J. et al. (2011) PLoS ONE 6, e17901. with permission of PLoS.

Last update: 08/06/2022

Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of rabbit CaV1.2a channel. Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013) can be used in western blot, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize CaV1.2a from mouse, rat and human samples.

For research purposes only, not for human use



Western blot citations
  1. Transfected CHO-K1 cells.
    Garau, G. et al. (2015) Exp. Neurol. 274, 156.
Immunoprecipitation citations
  1. Mouse brain homogenates (5 µg).
    Garau, G. et al. (2015) Exp. Neurol. 274, 156.
Immunohistochemistry citations
  1. Human cardiac tissue.
    Crossman, D.J. et al. (2011) PLoS ONE 6, e17901.
Immunocytochemistry citations
  1. c-kit+ cells from mouse bone marrow.
    Lagostena, L. et al. (2005) Cardiovasc. Res. 66, 482.
More product citations
  1. Wang, X.T. et al. (2000) Am. J. Pathol. 157, 1549.
  2. Shistik E. et al. (1999) J. Biol. Chem. 274, 31145.


Scientific Background

Shipping and Ordering information