Free shipping starts now, no minimum, no coupons required!

Anti-CHRM1 Antibody

Cholinergic muscarinic receptor 1, Muscarinic acetylcholine receptor M1

Cat #: AMR-001
Alternative Name Cholinergic muscarinic receptor 1, Muscarinic acetylcholine receptor M1
  • KO Validated
  • Lyophilized Powder yes
    Type: Polyclonal
    Host: Rabbit
    Reactivity: h, m, r
    • GST fusion protein with the sequence GSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRK, corresponding to amino acid residues 227-353 of human M1 (Accession P11229). 3rd intracellular loop.
    Accession (Uniprot) Number P11229
    Gene ID 1128
    Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.
    Homology Macaca mulatta - 125/127 amino acid residues identical; mouse - 124/127 amino acid residues identical; pig - 124/127 amino acid residues identical; rat - 123/127 amino acid residues identical; gerbil - 123/127 amino acid residues identical.
    RRID AB_2039993.
    Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
    Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
    Isotype Rabbit IgG.
    Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
    Reconstitution 25 μl, 50 μl or 0.2 ml double distilled water (DDW), depending on the sample size.
    Antibody concentration after reconstitution 0.85 mg/ml.
    Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
    Standard quality control of each lot Western blot analysis.
    Applications: ic, if, ih, wb
    May also work in: ifc*, ip*
    Western blot
    • Western blot analysis of rat brain membranes:
      Western blot analysis of rat brain membranes:
      1. Anti-CHRM1 Antibody (#AMR-001), (1:200).
      2. Anti-CHRM1 Antibody, preincubated with CHRM1 Blocking Peptide (#BLP-MR001).
    • Expression of Muscarinic acetylcholine receptor M1 in rat striatum
      Expression of Muscarinic acetylcholine receptor M1 in rat striatum
      Immunohistochemical staining of rat striatum (ST) using Anti-CHRM1 Antibody (#AMR-001). A. M1 mAChR appears in the striatum (green). B. Staining of interneurons with mouse anti-parvalbumin (PV, red). C. Confocal merge of M1 mAChR and PV demonstrates localization of PV expressing neurons in the striatal matrix; not in striatal patches (P).
    • Expression of Muscarinic acetylcholine receptor M1 in mouse striatum
      Expression of Muscarinic acetylcholine receptor M1 in mouse striatum
      Immunohistochemical staining of mouse striatum (ST) using Anti-CHRM1 Antibody (#AMR-001). A. M1 mAChR appears in the striatum (green). B. Staining of interneurons with mouse anti-parvalbumin (PV, red). C. Confocal merge of M1 mAChR and PV demonstrates localization of PV expressing neurons in the striatal matrix; not in striatal patches (P).
    • Human colon (1:50) (Harrington, A.M. et al. (2010) Neurogastroenterol. Motil. 22, 999.).
    • Transfected CHO cells (Kovoor, A. et al. (2005) J. Neurosci. 25, 2157.).
    1. Felder, C.C. et al. (2000) J. Med. Chem. 43, 4333.
    2. Forsythe, S.M. et al. (2002) Am. J. Respir. Cell. Mol. Biol. 26, 298.
    3. Ferreira, A.R. et al. (2003) Pharmacol. Biochem. Behav. 74, 411.
    4. Van der Zee, E.A. and Luiten, P.G. (1999) Prog. Neurol. 58, 409.
    5. Levey, A.I. et al. (1991) J. Neurosci. 11, 3218.
    6. Wang, J. et al. (2000) Am. J. Physiol. Gastrointest. Liver Physiol. 279, G1059.
    7. Budd, S.C. et al. (2003) J. Biol. Chem. 278, 19565.
    Scientific background

    The action of the neurotransmitter acetylcholine (ACh) is mediated through two types of receptors, the ionotrophic nicotinic receptors and the metabotrophic muscarinic receptors. The muscarinic receptors  belong to the superfamily of 7-TM G-protein-coupled receptors. Five subtypes of muscarinic receptors have been cloned and named M1-M5.1-2

    The muscarinic receptors are widely distributed throughout the body, but are predominantly expressed within the parasympathetic nervous system and exert both excitatory and inhibitory control over central and peripheral tissues.1-2

    Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing and motor control.1 They also participate in learning and memory processing.3-4 The M1 receptors are the most abundant muscarinic subtype in the cortex and striatum. M1 receptors were also localized in the myenteric plexus where they function as autoreceptors to enhance the release of ACh from the nerves.5-6

    The M1, M3 and M5 receptors, which are coupled to Gq/11 proteins, can protect cells from undergoing apoptosis induced by DNA damage. The signaling mechanism that mediates this anti-apoptotic response is still poorly understood. However, it was recently reported that a poly-basic motif in the C-terminus tail of the M1, M3 and M5 receptors is an essential element for the anti-apoptotic response of those receptors.7

    Application key:

    CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

    Species reactivity key:

    H- Human, M- Mouse, R- Rat
    Last update: 06/11/2022

    Alomone Labs is pleased to offer a highly specific antibody directed against the 3rd intracellular loop of the human M1 muscarinic receptor. Anti-CHRM1 Antibody (#AMR-001) can be used in western blot analysis, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize M1 from human, mouse and rat samples.

    For research purposes only, not for human use



    KO validation citations
    1. Mouse liver and brain lysates (1:1000). Tested in M1R-/- mice.
      Urrunaga, N.H. et al. (2015) Free Radic. Biol. Med. 78, 66.
    Western blot citations
    1. Mouse liver and brain lysates (1:1000). Tested in M1R-/- mice.
      Urrunaga, N.H. et al. (2015) Free Radic. Biol. Med. 78, 66.
    More product citations
    1. Harrington, A.M. et al. (2010) Neurogastroenterol. Motil. 22, 999.
    2. Kovoor, A. et al. (2005) J. Neurosci. 25, 2157.


    Scientific Background

    Shipping and Ordering information