Free shipping starts now, no minimum, no coupons required!

Certificate of Analysis

Astrocyte Antibody Marker Kit

A Screening Package of Astrocyte Marker Antibodies Economically Priced

Cat #: AK-665
Size: 6 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-GFAP Antibody Cat #: AFP-001

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
Peptide (C)RHLGTIPRLSLSR, corresponding to amino acid residues 27-39 of rat Glial fibrillary acidic protein (Accession P47819). Intracellular, cytoplasm.
Homology
Mouse – 10/13 amino acid residues identical.

Anti-EAAT1 (GLAST) (extracellular) Antibody Cat #: AGC-021

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, LCI, WB Reactivity: H, M, R
Immunogen
Peptide (C)KQFKTSYEKRSFK, corresponding to amino acids 188-200 of rat EAAT1 (Accession P24942). 2nd extracellular loop.
Homology
Mouse - identical; human 12/13 amino acid residues identical.

Anti-EAAT2 (GLT-1) (extracellular) Antibody Cat #: AGC-022

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, LCI, WB Reactivity: H, M, R
Immunogen
Peptide (C)KQLGPGKKNDEVS, corresponding to amino acid residues 151-163 of rat EAAT2 (Accession P31596). 2nd extracellular loop.
Homology
Mouse, human - identical.

Anti-GABA Transporter 3 (GAT-3) Antibody Cat #: AGT-003

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M, R
Immunogen
Peptide (C)REARDKAVHERGH, corresponding to amino acid residues 35-47 of rat GAT-3 (Accession P31647). Intracellular, N-terminus.
Homology
Mouse – identical.

Guinea pig Anti-Kir4.1 (KCNJ10) Antibody Cat #: AGP-012

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)KLEESLREQAEKEGSALSVR, corresponding to amino acid residues 356-375 of rat Kir4.1 (Accession P49655). Intracellular, C-terminus.
Homology
Human, mouse - identical.

Anti-Aquaporin 4 (AQP4) (249-323) Antibody Cat #: AQP-004

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4 (Accession P47863). Intracellular, C-terminus.
Homology
Mouse - 73/75 amino acid residues identical; bovine - 71/75 amino acid residues identical; human - 69/75 amino acid residues identical; rabbit - 64/75 amino acid residues identical.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For research purposes only, not for human use
Shipping and Ordering information