Cat #:
STB-470
Alternative Name K+ channel toxin γ-KTx 2.1, BeKm 1
Lyophilized Powder yes
Every lot is tried & tested in a relevant biological assay.
Our Bioassay
Origin Synthetic peptide
MW: 4092 Da
Purity: >98% (HPLC)
Effective concentration 2-10 nM.
Sequence RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF.
Modifications Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35.
Molecular formula C174H267N51O52S6.
Activity BeKm-1 inhibits ERG1 K+ channel currents and has minimal effect on ELK1 K+ channels.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs BeKm-1 inhibits KV11.1 channel current expressed in Xenopus oocytes.A. Representative time course of KV11.1 channel current inhibition by 10 nM BeKm-1 (#STB-470), as indicated (green). Membrane potential was held at -100 mV. Current was elicited every 10 sec by a 200 ms voltage step to 0 mV, followed by a 200 ms step to -20 mV. B. Superimposed traces of KV11.1 current after application of control solution (black) and of 10 nM BeKm-1 (green), taken from the recording in A.
References - Scientific background
- Korolkova, Y.V. et al. (2001) J. Biol. Chem. 276, 9868.
- Filippov, A.K. et al. (1996) FEBS Lett. 384, 277.
Scientific background BeKm-1 was originally isolated from Mesobuthus eupeus scorpion venom. BeKm-1 toxin blocked hERG1 channels expressed in HEK 293 cells with IC50 of 3.3 nM.1 The native toxin blocked M currents in differentiated mouse neuroblastoma X rat glioma NG108-15 cells with IC50 of 33 nM.2
Target KV11.1 K+ channels
Peptide Content: 100%
Lyophilized Powder
Last update: 09/11/2022
BeKm-1 (#STB-470) is a highly pure, synthetic, and biologically active peptide toxin.
For research purposes only, not for human use
Applications
Citations
Citations
Electrophysiology
- HEK 293 cells stably transfected with HERG (whole cell patch clamp).
Milnes, J.T. et al. (2003) FEBS Lett. 547, 20.
Product citations
- Niculescu, D. et al. (2013) J. Neurosci. 33, 16729.
- Ji, H. et al. (2012) Eur. J. Neurosci. 36, 2906.
- Qu, Y. et al. (2011) J. Pharmacol. Exp. Ther. 337, 2.
- Abi-Gerges, N. et al. (2011) Br. J. Pharmacol. 164, 419.
- Gerlach, A.C. et al. (2009) Mol. Pharmacol. 77, 58.
- Xu, X. et al. (2008) Mol. Pharmacol. 73, 1709.
Specifications
Scientific Background
Related Products
Related Products
Antibodies
Pharmacological tools
Blockers/Antagonists: peptides/peptide toxins
Blockers/Antagonists: small molecules
Explorer kits & Research packs
Shipping and Ordering information
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us