Overview
Cat #:
SPC-500
Alternative Name CaS
Lyophilized Powder yes
Origin Synthetic peptide
MW: 7036 Da
Purity: >98% (HPLC)
Form Lyophilized powder.
Effective concentration 500 nM.
Sequence RICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK.
Modifications Disulfide bonds between Cys3-Cys22, Cys17-Cys39, Cys41-Cys52 and Cys53-Cys58.
Molecular formula C299H468N90O87S10.
CAS No.: 178805-91-9
Activity Calciseptine is a specific antagonist of L-type CaV channels1.
References-Activity
- de Weille, J.R. et al. (1991) Proc. Natl. Acad. Sci. U.S.A. 88, 2437.
Accession number P22947.
Shipping and storage Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs Calciseptine inhibits CaV1.2 channel current expressed in Xenopus oocytes.A. Representative time course of Calciseptine (#SPC-500) inhibition of CaV1.2 channel currents. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +60 mV every 10 sec, and significantly inhibited by application of 1 µM Calciseptine (green). B. Superimposed traces of CaV1.2 current after application of control (black) and of 1 µM Calciseptine (green), taken from the recording in A.
Scientific background
Calciseptine is a peptide toxin originally isolated from the Dendroaspis p. polylepsis black mamba venom1 and shown to be a specific L-type CaV channel blocker2. However, in skeletal muscle, it increases L-type currents3.
Calciseptine blocks spontaneous or K+-induced contraction of cardiac and smooth muscle cells2. Using a patch clamp, it was also shown to block specifically L-type CaV channel currents in neuronal cells in culture2 with IC50 values of 15-500 nM. Using the outside-out configuration of patch clamp, it was shown to reduce single L-type channel's open probability and availability as recorded from the guinea pig portal vein4.
Target L-type Ca2+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 10/04/2023
Specifications
Citations
Citations