Certificate of Analysis

Cardiac CaChannel Antibody Explorer Kit

A Screening Package of Cardiac CaChannel Antibodies Economically Priced
Cat #: AK-310 14 Vials

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-CaV1.2 (CACNA1C) Antibody Cat #: ACC-003

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, WB Reactivity: H, M, R
Peptide (C)TTKINMDDLQPSENEDKS, corresponding to amino acid residues 848-865 of rat CaV1.2 (Accession P22002). Intracellular loop between domains II and III.
Rat, mouse - 8/11 amino acid residues identical.

Guinea pig Anti-CaV1.2 (CACNA1C) Antibody Cat #: AGP-001

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Peptide (C)TTKINMDDLQPSENEDKS, corresponding to amino acid residues 848-865 of rat CaV1.2 (Accession P22002). Intracellular loop between domains II and III.
Mouse - identical; guinea pig - 17/18 amino acid residues identical; human, rabbit - 16/18 amino acid residues identical.

Anti-CaV1.2a (CACNA1C) Antibody Cat #: ACC-013

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine (Accession P15381). Intracellular, N-terminus.
Rat, guinea pig - 31/46 amino acid residues identical.

Anti-Human CaV1.2 (CACNA1C) Antibody Cat #: ACC-022

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, WB Reactivity: H, M, R
Peptide VNENTRMYIPEENHQ(C), corresponding to amino acid residues 2-15 of human CaV1.2 (exon 1B) (Accession Q13936). Intracellular, N-terminus.
Mouse, rat - 14/15 amino acid residues identical.

Anti-CACNA1G (CaV3.1) Antibody Cat #: ACC-021

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Peptide MDEEEDGAGAEESGQPRSFTQL(C), corresponding to amino acid residues 1-22 of rat CACNA1G (Accession O54898). Intracellular, N-terminus.
Mouse - identical; human - 20/22 amino acid residues identical.

Anti-CaV3.2 (CACNA1H) Antibody Cat #: ACC-025

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Peptide CHVEGPQERARVAHS, corresponding to amino acid residues 581-595 of rat CaV3.2 (Accession number Q9EQ60). Intracellular loop between domains D1 and D2.
Mouse, bovine and canis - 14/15 amino acid residues identical; human - 13/15 amino acid residues identical.

Anti-CACNG6 (extracellular) Antibody Cat #: ACC-112

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Peptide CIKRLWQADVPAGR, corresponding to amino acid residues 87-100 of rat CACNG6 (Accession Q8VHW3).
Mouse – identical; human – 11/14 amino acid residues identical.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.


Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution


Preadsorption control

1 μg peptide per 1 μg antibody.

A Guinea pig polyclonal antibody (#AGP-001) is included in this Explorer Kit. Please take into account when reacting with a secondary antibody.