Free shipping starts now, no minimum, no coupons required!

Certificate of Analysis

CaV1.2 (CACNA1C) Channel Deluxe Research Pack

All You Need for CaV1.2 (CACNA1C) Channel Research

Cat #: ESD-100
Size: 8 Vials
Form: Lyophilized


Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-CaV1.2 (CACNA1C) Antibody Cat #: ACC-003

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, WB Reactivity: H, M, R
Peptide (C)TTKINMDDLQPSENEDKS, corresponding to amino acid residues 848-865 of rat CaV1.2 (Accession P22002). Intracellular loop between domains II and III.
Mouse - identical; guinea pig - 17/18 amino acid residues identical; human, rabbit - 16/18 amino acid residues identical.

Anti-CaV1.2 (CACNA1C)-ATTO Fluor-488 Antibody Cat #: ACC-003-AG

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH Reactivity: H, M, R
Peptide (C)TTKINMDDLQPSENEDKS, corresponding to amino acid residues 848-865 of rat CaV1.2 (Accession P22002). Intracellular loop between domains II and III.
Mouse - identical; guinea pig - 17/18 amino acid residues identical; human, rabbit - 16/18 amino acid residues identical.
ATTO-488. Maximum absorption 501 nm; maximum fluorescence 523 nm. The fluorescence is excited most efficiently in the 480 – 515 nm range. This label is analogous to the well known dye fluorescein isothiocyanate (FITC) and can be used with filters typically used to detect FITC.

Guinea pig Anti-CaV1.2 (CACNA1C) Antibody Cat #: AGP-001

Size: 0.2 ml Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Peptide (C)TTKINMDDLQPSENEDKS, corresponding to amino acid residues 848-865 of rat CaV1.2 (Accession P22002). Intracellular loop between domains II and III.
Mouse - identical; guinea pig - 17/18 amino acid residues identical; human, rabbit - 16/18 amino acid residues identical.

Anti-Human CaV1.2 (CACNA1C) Antibody Cat #: ACC-022

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, WB Reactivity: H, M, R
Peptide VNENTRMYIPEENHQ(C), corresponding to amino acid residues 2-15 of human CaV1.2 (exon 1B) (Accession Q13936). Intracellular, N-terminus.
Mouse, rat - 14/15 amino acid residues identical.

Anti-CaV1.2a (CACNA1C) Antibody Cat #: ACC-013

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine (Accession P15381). Intracellular, N-terminus.
Rat, guinea pig - 31/46 amino acid residues identical.

Pharmacological Reagents

(±)-Bay K8644 Cat #: B-350

Size: 25 mg Source: Synthetic MW: 356.3 Purity: >99% (HPLC)
Effective concentration
1-5 μM.
(±)-Bay K8644 is a dihydropyridine that acts as an L-type, voltage-gated Ca2+ channel agonist. The (-)-enantiomer has strong Ca2+ channel agonist properties, whereas the (+)-enantiomer has weak Ca2+ channel antagonist activity. The net activity of the racemic mix is L-type channel opening. In the presence of this agonist, channels tend to open for longer periods causing a large increase in the channel microscopic response1-4. (±)-Bay K8644 is also an inhibitor (by increasing the inactivation) of a Shaker KV channel5.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Ethanol, methanol or DMSO. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to four weeks at 4°C or three months at -20°C.

FPL 64176 Cat #: F-160

Size: 10 mg Source: Synthetic MW: 347.4 Purity: >99% (HPLC)
Effective concentration
10 nM - 1 µM.
FPL 64176 is an L-type Ca2+ channel activator, which induces contraction in rat tail artery1.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
100 mM in DMSO. Centrifuge all product preparations before use (10 000 x g for 1 min).
Storage after reconstitution
Up to four weeks at 4°C or three months at -20°C.

SR 33805 oxalate Cat #: S-105

Size: 10 mg Source: Synthetic MW: 654.77 Purity: >96%
Effective concentration
1 nM - 10 μM.
SR 33805, a fantofarone derivative, is a potent Ca2+ channel antagonist1. It binds allosterically to the α1-subunit of L-type Ca2+ channels (Kd = 20 pM), at a site distinct from other types of blockers2. It potently inhibits the Ca2+ channel in primary mouse cardiac myocytes cultures with IC50 values ranging from 4 to 33 nM3.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
DMSO. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to four weeks at 4°C or three months at -20°C.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.


Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution


Preadsorption control

1 μg peptide per 1 μg antibody.

For more information, please refer to individual certificate of analysis for each product.


A guinea pig polyclonal antibody (#AGP-001) is included in this Research Pack. Please take into account when reacting with a secondary antibody.

CaV1.2 (CACNA1C) Channel Overexpressed Membrane Fractions includes:
1 x 0.1 ml lyophilized CaV1.2 channel overexpressed membrane fractions
1 x 0.1 ml lyophilized non-injected Xenopus oocyte membrane fractions

For research purposes only, not for human use
Shipping and Ordering information