Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 

Navigation

Alomone Labs Alomone Labs

Order Summary

Home

main

    • column
      • Ion Channels
    • column
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
    • column
      • Cell Imaging Tools
      • Research Areas
  • Home
  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Free Sample Program
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • Nav Channels
      • Microglia Markers
      • Blog
      • Tips
      • Articles
    • column
      • Protocols
      • FAQs and Troubleshooting
      • Citations Search Tool
      • Download Protocol Book
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
      • Subscribe – Printed Magazines
Return to Content
Home › Products › Ion Channels › Ca2+ Signaling › Voltage-Gated Ca2+ Channels › Antibodies to CaV Channels

Certificate of Analysis

CaV1.2 (CACNA1C) Channel Premium Research Pack

All You Need for CaV1.2 (CACNA1C) Channel Research

Back to product page
Cat #: ESP-100
Size: 11 Vials
Form: Lyophilized

Antibodies

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-CaV1.2 (CACNA1C) Antibody Cat #: ACC-003

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)TTKINMDDLQPSENEDKS, corresponding to amino acid residues 848-865 of rat CaV1.2 (Accession P22002). Intracellular loop between domains II and III.
Homology
Mouse - identical; guinea pig - 17/18 amino acid residues identical; human, rabbit - 16/18 amino acid residues identical.

Guinea pig Anti-CaV1.2 (CACNA1C) Antibody Cat #: ACC-003-GP (formerly AGP-001)

Size: 0.2 ml Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)TTKINMDDLQPSENEDKS, corresponding to amino acid residues 848-865 of rat CaV1.2 (Accession P22002). Intracellular loop between domains II and III.
Homology
Mouse - identical; guinea pig - 17/18 amino acid residues identical; human, rabbit - 16/18 amino acid residues identical.

Anti-Human CaV1.2 (CACNA1C) Antibody Cat #: ACC-022

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, WB Reactivity: H, M, R
Immunogen
Peptide VNENTRMYIPEENHQ(C), corresponding to amino acid residues 2-15 of human CaV1.2 (exon 1B) (Accession Q13936). Intracellular, N-terminus.
Homology
Mouse, rat - 14/15 amino acid residues identical.

Anti-CaV1.2a (CACNA1C) Antibody Cat #: ACC-013

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine (Accession P15381). Intracellular, N-terminus.
Homology
Rat, guinea pig - 31/46 amino acid residues identical.

Pharmacological Reagents

(±)-Bay K8644 Cat #: B-350

Size: 25 mg Source: Synthetic MW: 356.3 Purity: >99% (HPLC)
Effective concentration
1-5 μM.
Activity
(±)-Bay K8644 is a dihydropyridine that acts as an L-type, voltage-gated Ca2+ channel agonist. The (-)-enantiomer has strong Ca2+ channel agonist properties, whereas the (+)-enantiomer has weak Ca2+ channel antagonist activity. The net activity of the racemic mix is L-type channel opening. In the presence of this agonist, channels tend to open for longer periods causing a large increase in the channel microscopic response1-4. (±)-Bay K8644 is also an inhibitor (by increasing the inactivation) of a Shaker KV channel5.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Ethanol, methanol or DMSO. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to four weeks at 4°C or three months at -20°C.

FPL 64176 Cat #: F-160

Size: 10 mg Source: Synthetic MW: 347.4 Purity: >99% (HPLC)
Effective concentration
10 nM - 1 µM.
Activity
FPL 64176 is an L-type Ca2+ channel activator, which induces contraction in rat tail artery1.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
100 mM in DMSO. Centrifuge all product preparations before use (10 000 x g for 1 min).
Storage after reconstitution
Up to four weeks at 4°C or three months at -20°C.

SR 33805 oxalate Cat #: S-105

Size: 10 mg Source: Synthetic MW: 654.77 Purity: >96%
Effective concentration
1 nM - 10 μM.
Activity
SR 33805, a fantofarone derivative, is a potent Ca2+ channel antagonist1. It binds allosterically to the α1-subunit of L-type Ca2+ channels (Kd = 20 pM), at a site distinct from other types of blockers2. It potently inhibits the Ca2+ channel in primary mouse cardiac myocytes cultures with IC50 values ranging from 4 to 33 nM3.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
DMSO. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to four weeks at 4°C or three months at -20°C.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For more information, please refer to individual certificate of analysis for each product.
Note

A guinea pig polyclonal antibody (#ACC-003-GP) is included in this Research Pack. Please take into account when reacting with a secondary antibody.

CaV1.2 (CACNA1C) Channel Overexpressed Membrane Fractions includes:
1 x 0.1 ml lyophilized CaV1.2 channel overexpressed membrane fractions
1 x 0.1 ml lyophilized non-injected Xenopus oocyte membrane fractions

For research purposes only, not for human use

Related Products

  1. CaV1.2 (CACNA1C) Channel Basic Research Pack (#ESB-100)
  2. CaV1.2 (CACNA1C) Channel Deluxe Research Pack (#ESD-100)
  3. Anti-CaV1.2 (CACNA1C)-ATTO Fluor-488 Antibody (#ACC-003-AG)
  4. CaV1.2 (CACNA1C) Channel Antibody and Membrane Fractions Kit (#LK-104A)
  5. CaV1.2a (CACNA1C) Channel Antibody and Membrane Fractions Kit (#LK-104B)
  6. Calcicludine (#SPC-650)
  7. Felodipine (#F-105)
  8. Nisoldipine (#N-160)
  9. Verapamil HCl (#V-100)
  10. Cardiac CaV Channel Antibody Explorer Kit (#AK-310)
  11. L-Type CaV Channel Antibody Explorer Kit (#AK-215)
  12. L-Type CaV Channel Blocker Explorer Kit (#EK-103)

Resources

  • L-Type (CaV1) Channels

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.


Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!


Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Resources

  • L-Type (CaV1) Channels

Need Help With This Product?

Our reagent specialists are here to help you find the best product for your application. Please message us and we will be happy to help you find the right product for the job.

Contact Us

Contact Us

© 2023 Alomone Labs. All Rights Reserved.

Terms of Service Privacy Policy
Scroll to top