Cat #: BLP-CC013
Size: 0.15 mg
Type: GST fusion protein
Form: Lyophilized powder
Applications: wb, ihc
Application key:
WB- Western blot, IHC- Immunohistochemistry
For research purposes only. not for human use
Properties
Sequence
- GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine (Accession P15381).
Accession (Uniprot) Number P15381
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Applications
Demonstration of Pre-adsorption control
- Western blot analysis of rat heart membranes:1. Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013), (1:200).
2. Anti-CaV1.2a (CACNA1C) Antibody, preincubated with Cav1.2a/CACNA1C Blocking Peptide (#BLP-CC013). - Rat paraffin heart section (see also reference 2 of recent publications using this product).
Human cardiac tissue (Crossman, D.J. et al. (2011) PLoS ONE 6, e17901.).
Last update: 02/01/2024