GTx1-15

ω/β-Theraphotoxin-Ps2a, β-TRTX-Ps2a, Peptide E
 A Blocker of Voltage-Gated Na+ and T-Type Ca2+ Channels
    Cat #: STT-300
    Alternative Name ω/β-Theraphotoxin-Ps2a, β-TRTX-Ps2a, Peptide E
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 4075 Da.
    Purity: >98% (HPLC)
    Effective concentration 200-500 nM.
    Sequence DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF.
    Modifications Disulfide bonds between Cys2-Cys17, Cys9-Cys23, Cys16-Cys30, Phe34 - C-terminal amidation.
      • This product is sold under license from Alomone Preclinical Ltd.
        GTx1-15
    Molecular formula C176H271N53O45S7.
    Activity GTx1-15 inhibits rat NaV1.3 and NaV1.7 voltage-gated Na+ channels as well as T-type Ca2+ channels.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer, pH > 8. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • GTx1-15
        Alomone Labs GTx1-15 inhibits rat NaV1.3 channels heterologously expressed in HEK-293 cells.
        A. Dose-response of NaV1.3 channel inhibition by GTx1-15 (#STT-300). The inhibition was measured in 3-5 cells for each dose. B. Example of superimposed current traces of rat NaV1.3 channel activity before and during application of 0.3 µM of GTx1-15. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 40 msec from holding potential to +60 mV.
    References - Scientific background
    • 1. Meir, A., Cherki, R.S., Kolb, E., Langut, Y., Bajayo, N., 2011. Novel peptides isolated from spider venom, and uses thereof. U.S. Patent Application Publication # US 2011/0065647 A1.
    • 2. Ono, S. et al. (2011) Toxicon. 58, 265.
    • 3. Sheets, P.L. et al. (2008) J. Pharmacol. Exp. Ther. 326, 89.
    • 4. Zimmermann, K. et al. (2007) Nature 447, 855.
    • 5. Amir, R. et al. (2006) J. Pain 7, S1.
      • GTx1-15 is isolated from the Grammostola rosea (Phrixotrichus auratus) spider venom and is a synthetic version of the peptide1,2.

        GTx1-15 inhibits voltage-gated rat NaV1.3 and NaV1.7 Na+ channels, as well as T-type Ca2+ channels1,2.

        Voltage-gated Na+ channels (VGSC, NaV) play a critical role in excitability of nociceptors (pain-sensing neurons).

        The peripheral-specific Na+ channels NaV1.7, NaV1.8 and NaV1.9 are particularly important in the pathophysiology of different pain syndromes and hence, thought to be potential targets for pain therapeutics3-4. The expression and functional properties of NaV channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation5.

        GTx1-15 shows high homology to Phrixotoxin-3 (#STP-720) (76%) and Ceratotoxin-2 (#STC-100) (57%).

    Target NaV Na+ Channels, T-type Ca2+ channels
    Net Peptide Content: 100%

    Widget not in any sidebars
    Last update: 23/09/2019

    GTx1-15 (#STT-300) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use

    Widget not in any sidebars