Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 
Alomone Labs Alomone Labs

Order Summary

Home

main

    • column
      • Ion Channels
    • column
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
    • column
      • Cell Imaging Tools
      • Research Areas
  • Home
  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • Protocols
      • FAQs and Troubleshooting
      • Citations Search Tool
    • column
      • Blog
      • Articles
      • Download Protocol Book
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
      • Subscribe – Printed Magazines
Return to Content
Home › Products › Ion Channels › Ca2+ Signaling › Voltage-Gated Ca2+ Channels › Blockers

Certificate of Analysis

GTx1-15

ω/β-Theraphotoxin-Ps2a, β-TRTX-Ps2a, Peptide E

 A Blocker of Voltage-Gated Na+ and T-Type Ca2+ Channels

Cat #: STT-300
Alternative Name ω/β-Theraphotoxin-Ps2a, β-TRTX-Ps2a, Peptide E
Lyophilized Powder yes
  • Bioassay Tested

    Every lot is tried & tested in a relevant biological assay.
    Our Bioassay

  • Origin Synthetic peptide
    MW: 4075 Da
    Purity: >98% (HPLC)
    Effective concentration 200-500 nM.
    Sequence DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF.
    Modifications Disulfide bonds between Cys2-Cys17, Cys9-Cys23, Cys16-Cys30, Phe34 - C-terminal amidation.
    Structure
    Molecular formula C176H271N53O45S7.
    Activity GTx1-15 inhibits rat NaV1.3 and NaV1.7 voltage-gated Na+ channels as well as T-type Ca2+ channels.
    Accession number P0DJA9.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer, pH > 8. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs GTx1-15 inhibits rat NaV1.3 channels heterologously expressed in HEK-293 cells.
      Alomone Labs GTx1-15 inhibits rat NaV1.3 channels heterologously expressed in HEK-293 cells.
      A. Dose-response of NaV1.3 channel inhibition by GTx1-15 (#STT-300). The inhibition was measured in 3-5 cells for each dose. B. Example of superimposed current traces of rat NaV1.3 channel activity before and during application of 0.3 µM of GTx1-15. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 40 msec from holding potential to +60 mV.
    Scientific background

    GTx1-15 is isolated from the Grammostola rosea (Phrixotrichus auratus) spider venom and is a synthetic version of the peptide1,2.

    GTx1-15 inhibits voltage-gated rat NaV1.3 and NaV1.7 Na+ channels, as well as T-type Ca2+ channels1,2.

    Voltage-gated Na+ channels (VGSC, NaV) play a critical role in excitability of nociceptors (pain-sensing neurons).

    The peripheral-specific Na+ channels NaV1.7, NaV1.8 and NaV1.9 are particularly important in the pathophysiology of different pain syndromes and hence, thought to be potential targets for pain therapeutics3-4. The expression and functional properties of NaV channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation5.

    GTx1-15 shows high homology to Phrixotoxin-3 (#STP-720) (76%) and Ceratotoxin-2 (#STC-100) (57%).

    Target NaV Na+ Channels, T-type Ca2+ channels
    Peptide Content: 100%
    Lyophilized Powder
    Back to product pageSDSNew Generate a Quote
    Last update: 06/12/2022

    See Related Products

    For research purposes only, not for human use

    Specifications

    Citations

    Citations

    Applications

    Scientific Background

    Shipping and Ordering information
      Back to product pageSDSNew Generate a Quote

      Resources

      • NaV1.7 Channels
      • T-Type (CaV3) Channels

      Free International Shipping

      Products are lyophilized and ship at room temperature - FREE OF CHARGE.

      We ship worldwide within 24 hours of our next business day.

      For more country-specific shipping and contact information see Ordering & Shipping.


      Free Sample Program

      Not sure whether the product fits your experimental setup?

      Try it first!


      Alomone Guarantee

      We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

      Alomone Guarantee information

      Resources

      • NaV1.7 Channels

      • T-Type (CaV3) Channels

      Need Help With This Product?

      Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

      Call us at
      +972 2587 2202 or Email Us

      Contact Us

      © 2023 Alomone Labs. All Rights Reserved.

      Terms of Service Privacy Policy
      Scroll to top

      Bulk / Customized order