Name: GTx1-15
Brand: Alomone Labs
SKU: STT-300

Cat #: STT-300

Alternative Name ω/β-Theraphotoxin-Ps2a, β-TRTX-Ps2a, Peptide E

Lyophilized Powder yes

Bioassay Tested

Origin Synthetic peptide

MW: 4075 Da

Purity: >98% (HPLC)

Effective concentration 200-500 nM.

Sequence DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF.

Modifications Disulfide bonds between Cys²-Cys¹⁷, Cys⁹-Cys²³, Cys¹⁶-Cys³⁰, Phe³⁴ - C-terminal amidation.

Structure

Molecular formula C₁₇₆H₂₇₁N₅₃O₄₅S₇.

Activity GTx1-15 inhibits rat Na_V1.3 and Na_V1.7 voltage-gated Na⁺ channels as well as T-type Ca²⁺ channels.

Accession number P0DJA9.

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Solubility Any other aqueous buffer, pH > 8. Centrifuge all product preparations before use (10000 x g 5 min).

Storage of solutions Up to two weeks at 4°C or three months at -20°C.

Our bioassay

Alomone Labs GTx1-15 inhibits rat Na_V1.3 channels heterologously expressed in HEK-293 cells.
A. Dose-response of Na_V1.3 channel inhibition by GTx1-15 (#STT-300). The inhibition was measured in 3-5 cells for each dose. B. Example of superimposed current traces of rat Na_V1.3 channel activity before and during application of 0.3 µM of GTx1-15. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 40 msec from holding potential to +60 mV.

Scientific background

GTx1-15 is isolated from the Grammostola rosea (Phrixotrichus auratus) spider venom and is a synthetic version of the peptide^1,2.

GTx1-15 inhibits voltage-gated rat Na_V1.3 and Na_V1.7 Na⁺ channels, as well as T-type Ca²⁺ channels^1,2.

Voltage-gated Na⁺ channels (VGSC, Na_V) play a critical role in excitability of nociceptors (pain-sensing neurons).

The peripheral-specific Na⁺ channels Na_V1.7, Na_V1.8 and Na_V1.9 are particularly important in the pathophysiology of different pain syndromes and hence, thought to be potential targets for pain therapeutics^3-4. The expression and functional properties of Na_V channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation⁵.

GTx1-15 shows high homology to Phrixotoxin-3 (#STP-720) (76%) and Ceratotoxin-2 (#STC-100) (57%).

Target Na_V Na⁺ Channels, T-type Ca²⁺ channels

Peptide Content: 100%

Lyophilized Powder

Last update: 06/12/2022

For research purposes only, not for human use

Specifications

Citations

Applications

Scientific Background

Shipping and Ordering information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.

Free Sample Program

Not sure whether the product fits your experimental setup?

Try it first!

Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Order Summary

Certificate of Analysis

GTx1-15

Specifications

Citations

Applications

Scientific Background

Resources

Need Help With This Product?