Free shipping starts now, no minimum, no coupons required!

Hj2a Toxin

Delta-buthitoxin-Hj2a, Delta-BUTX-Hj2a

A Potent Activator of Nav1.1, Nav1.4, Nav1.5, Nav1.6 and Nav1.7 Channels.

Cat #: STH-555
Alternative Name Delta-buthitoxin-Hj2a, Delta-BUTX-Hj2a
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Hottentotta judaicus (Black scorpion) (Buthotus judaicus)
    Source Synthetic peptide
    MW: 7118 Da
    Purity: >98%
    Form Lyophilized Powder
    Effective concentration 20-500 nM
    Sequence GRDAYIADDKNCVYTCAKNSYCNNECTKNGAESGYCQWLGKYGNGCWCKNLPDKVPIRIPGPCR-NH2
    Modifications Disulfide bonds between: Cys12-Cys63, Cys16-Cys36, Cys22-Cys46 and Cys26-Cys48
    Arg64 - Arginine amide
    Structure
    Molecular formula C304H457N89O94S8
    Activity Hj2a is an agonist of NaV1.1 which presents dual α/β activity by modifying both the activation and inactivation properties of the channel1.
    References-Activity
    1. Chow, C.Y. et al. (2020) ACS Pharmacol. Transl. Sci. 3, 119.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Protect from light and moisture.
    Solubility Soluble in water. It is recommended to prepare fresh solutions in working buffers before use, or aliquot stock solutions reconstituted in distilled water and keep at -20°C. Upon use, dilute the stock solution in the desired working buffer. Prevent repeated thawing and freezing cycles.
    Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C.
    Our bioassay
    • Alomone Labs Hj2a Toxin enhances the current of NaV1.6 channels expressed in Xenopus oocytes.
      Alomone Labs Hj2a Toxin enhances the current of NaV1.6 channels expressed in Xenopus oocytes.
      A. Representative time course of Hj2a Toxin (#STH-555) effect on the normalized area of NaV1.6 channel current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage step to 0 mV every 10 sec, and was significantly enhanced by the application of 0.5 μM Hj2a Toxin (green). B. Superimposed traces of NaV1.6 current after application of control (black) and of 0.5 μM Hj2a Toxin (green), taken from the recording in A.
    References - Scientific background
    1. Chow, C.Y. et al. (2020) ACS Pharmacol. Transl. Sci. 3, 119.
    2. Depienne, C. et al. (2008) J. Med. Genet. 46, 183.
    Scientific background

    δ-buthitoxin-Hj2a (Hj2a) is a peptidyl toxin originally isolated from the venom of the scorpion, Hottentotta jayakari. Hj2a acts as a voltage-gated sodium (Nav) 1.1 channel activator, but it also harbors promiscuous activity towards multiple human NaV channel subtypes. Hj2a is unique in that it exhibits a dual α/β mode of action by modifying both the inactivation (α-toxin activity) and activation (β-toxin activity) properties of the NaV1.1 channel1.

    NaV channels are involved in a wide array of physiological processes and play a fundamental role in normal neurological function, especially in the initiation and propagation of action potentials. In particular, the NaV1.1 channel is predominantly expressed in inhibitory interneurons of the brain and it plays a major role in regulating brain rhythms and cognitive functions. Mutations in the NaV1.1 channel were shown to be associated with Dravet syndrome (DS), a severe form of pediatric epilepsy. Selective modulators of the NaV1.1 channel can be useful therapeutics for DS treatment since they target the underlying molecular deficit. The unusual dual mode of action of Hj2a provides an alternative approach for the development of selective NaV1.1 channel modulators for the treatment of DS1,2.

    Target NaV1.1, Voltage-gated Na+ channels
    Net Peptide Content: 100%
    Last update: 11/04/2021

    Hj2a Toxin (#STH-555) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use
    Shipping and Ordering information