human BDNF

Brain-Derived Neurotrophic Factor
Human Brain-Derived Neurotrophic Factor, Recombinant, E. coli
    Cat #: B-250
    Sizes: 1 µg, 5 x 1 µg, 5 µg, 10 µg, 25 µg, 50 µg, 0.1 mg, 0.25 mg, 0.5 mg, 1 mg
  • Promotion
  • Lyophilized Powder
  • Bioassay Tested
  • Shipped at Room Temp.
  • 100% Net Peptide
  • Sterile & Endotoxin Free
  • Source: Recombinant, E. coli
    MW: 27 kDa.
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity >98%.
    Formulation Lyophilized from a 0.2 µm filtered solution.
    Effective concentration ED50 = 220 pM.
    Sequence HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR.
    Structure
    Activity BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8.
    Storage before reconstitution Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Reconstitution Sterile water at a concentration of at least 1 µg/0.1 ml. BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage after reconstitution Up to one week at 4°C or four-six weeks at -70°C.
    Our bioassay
    Alomone Labs BDNF induces ERK1/2 MAPK phosphorylation of the neurotrophin receptor tyrosine kinase B (TrkB) transfected HEK-293 cells.
    Transfected cells were serum depleted for 2 h 3 days post-transfection and then challenged with 20 ng/ml human BDNF (#B-250) for 10 min. The cell proteins were resolved by SDS-PAGE and detected with anti-TrkB and anti-phospho-ERK1/2.
    References
    1. Robinson, R.Cet al. (1995) Biochemistry 34, 4139.
    2. Ibanez, C.F. (1998) Trends Neurosci. 21, 438.
    3. Wetmore, Cet al. (1990) Exp. Neurol. 109, 141.
    4. Thoenen, Het al. (1991) Ann. N. Y. Acad. Sci. 640, 86.
    5. Tolkovsky, A. (1997) Trends Neurosci. 20, 1.
    6. Jing, Set al. (1992) Neuron 9, 1067.
    7. Acheson, Aet al. (1995) Nature 374, 450.
    8. Morse, J.Ket al. (1993) J. Neurosci. 13, 4146.
    9. Hyman, Cet al. (1991) Nature 350,230.
    10. Friedman, Bet al. (1995) J. Neurosci. 15, 1044.
    11. Meyer, Met al. (1992) J. Cell Biol. 119, 45.
    12. Koliatsos, V.Eet al. (1993) Neuron 10, 359.
    13. Rodriguez-Tebar, Aet al. (1992) EMBO J. 11, 917.
    14. Chun, H.Set al. (2000) Neuroreport 11, 511.
    Net Peptide Content: 100%

    Promotion

    Use code: pop-30-1718

    Special discount

    Last update: 15/02/2018

    Brain-Derived Neurotrophic Factor (BDNF) is a member of the NGF family of neurotrophic growth factors, and shares high sequence homology with NGF, NT-3 and NT-4/5.1,2 BDNF is found in neurons of the central nervous system. It is expressed predominantly in hippocampus, cortex, and amygdaloid complex.3

    The synthesis of BDNF is subject to regulation by neuronal activity and specific transmitter systems.4

    BDNF binds to p75NTR, the neurotrophin receptor, and may initiate programmed cell death by acting through this receptor.5 Signal transduction is activated by the dimerization and autophosphorylation of the TrkB receptor.6

    BDNF supports the survival of primary sensory neurons,7 retinal ganglion cells, basal forebrain cholinergic neurons,8 and mesencephalic dopaminergic neurons in vitro.9 BDNF prevents death of cultured rat spinal motor neurons,10 and rescues substantial numbers of motor neurons after lesioning of the neonatal sciatic or facial nerve.11 Expression is switched on in Schwann cells following peripheral nerve lesion.11 BDNF also inhibits the normal cell death of embryonic chick motor neurons.12

    BDNF acts in concert with other factors and neurotrophins. The biological activities of BDNF and NT-3 (neurotrophin-3) are additive, and BDNF also interacts with LIF.13

    The effects of BDNF on motor neurons raise the possibility that it may be useful in treating patients with motor neuropathies and Amyotrophic Lateral Sclerosis (ALS).14

    Alomone Labs is pleased to offer human BDNF (#B-250), a recombinant protein expressed in and extracted from E. coli and purified to homogeneity.

    For research purposes only, not for human use

    For a list of product citations in the literature, see “product citations” below. If you know of additional relevant citations for this product, please let us know.

    Citations
    Product citations
    1. Hurtado, E. et al. (2017) Front. Mol. Neurosci. 10, 147.

    2. Katche, C. and Medina, J.H. (2017) Cereb. Cortex 27, 1060.
    3. Myrum, C. et al. (2017) Front. Cell. Neurosci. 11, 294.

    4. Cordon-Barris, L. et al. (2016) Mol. Cell. Biol. 36, 2967.
    5. de la Cruz-Morcillo, M.A. et al. (2016) Oncotarget 7, 34480.
    6. Forster, J.I. et al. (2016) J. Biomol. Screen. 21, 496.
    7. Gaub, P. et al. (2016) PLoS ONE 11, e0150601.
    8. Luo, C. et al. (2016) Sci. Rep. 6, 27171.
    9. Slomnicki, L.P. et al. (2016) J. Biol. Chem. 291, 5721.
    10. Yan, L. et al. (2016) Sci. Rep. 6, 30014.
    11. Yan, Y. et al. (2016) Neuropharmacology 107, 227.
    12. Fulgenzi, G. et al. (2015) J. Cell Biol. 210, 1003.
    13. Genheden, M. et al. (2015) J. Neurosci. 35, 972.
    14. Hane, M. et al. (2015) Glycobiology 25, 1112.
    15. Jablonski, A.M. et al. (2015) J. Neurosci. 35, 14286.
    16. Nosheny, R.L. et al. (2015) Neurobiol. Dis. 77, 173.
    17. Zahavi, E.E. et al. (2015) J. Cell Sci. 128, 1241.
    18. Zeinieh, M. et al. (2015) J. Cell Sci. 128, 447.
    19. Zhai, J. et al. (2015) J. Neurosci. 35, 9088.
    20. Vega-Melendez, G.S. et al. (2014) J. Neurosci. Res. 92, 13.
    21. Collo, G. et al. (2013) Mol. Pharmacol. 83, 1176.
    22. Finsterwald, C. et al. (2013) PLoS ONE 8, e54545.
    23. Kelly, C.E. et al. (2013) PLoS ONE 11, e1001538.
    24. Lalchandani, R.R. et al. (2013) J. Neurosci. 33, 14075.
    25. Ovejero-Benito, M.C. and Frade, J.M. (2013) PLoS ONE 5, e64890.
    26. Zurashvili, Tet al. (2013) Mol. Cell Biol. 33, 1027.
    27. Wright, M.A. and Ribera, A.B. (2010) J. Neurosci. 30, 14513.
    28. Gomez-Palacio-Schjetnan A. and Escobar M.L. (2008) NeurosciLett. 445, 62.
    Related Products