Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 
Alomone Labs Alomone Labs

Order Summary

Sign In

Forgot your password?

New customer? Create an account
Home

main

    • column
      • Ion Channels
    • column
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
    • column
      • Cell Imaging Tools
      • Research Areas
  • Home
  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Kits & Packs
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Resources
    • column
      • Protocols
      • Magazines
      • Featured Papers
    • column
      • Live Cell Imaging Catalog
  • Service & Support
    • column
      • Service & Support
      • FAQs
      • Ordering & Shipping
    • column
      • Free Sample Program
      • Alomone Guarantee
      • Online Quotes New
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
      • Subscribe – Printed Magazines
Return to Content
Home › Products › Neurotrophic Factors and Receptors › Glial-Derived Neurotrophic Factor (GDNF) Family › Proteins

Certificate of Analysis

human GDNF proDomain

Human Glial-Derived Neurotrophic Factor proDomain, Synthetic

Cat #: SPG-100
Lyophilized Powder yes
Sterile & Endotoxin Free yes
Origin Synthetic peptide
MW: 6334 Da
Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
Purity: >98% (HPLC)
Form Lyophilized from a 0.2 µm filtered solution.
Sequence FPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRL.
Structure
Molecular formula C279H433N79O86S2.
Activity Different peptides which are part of the GDNF proDomain sequence can induce synaptic excitability and possess some dopaminergic activities in vitro (thus named dopamine neuron-stimulating peptides), in addition to possessing neurotrophic-like properties1-3.
References-Activity
  1. Bradley, L.H. et al. (2010) PLoS ONE 5, e9752.
  2. Immonen, T. et al. (2008) Exp. Neurol. 210, 793.
  3. Kelps, K.A. et al. (2011) Neuropeptides 45, 213.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer with pH > 8. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Scientific background

Glial-Derived Neurotrophic Factor (GDNF) is a member of the TGF-β superfamily. GDNF signals through a multi-component receptor system, composed of a RET protooncogene and one of the four α1-α4 receptors1.

GDNF promotes survival of various neuronal cells, including motoneurons2,3, Purkinje cells and sympathetic neurons4. In embryonic midbrain cultures, GDNF promotes the survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake5. Cells that express GDNF include Sertoli cells, type 1 astrocytes, Schwann cells6, neurons, pinealocytes, and skeletal muscle cells7.

In vivo, following transection of facial motor neuron axons, locally applied GDNF has been shown to rescue virtually all damaged neurons from death8. GDNF may be of clinical relevance in the treatment of Parkinson's disease that is characterized by progressive degeneration of midbrain dopaminergic neurons9,10.

Recently, it has been hypothesized that functional, carboxy-terminally amidated peptides are processed from the GDNF precursor upon proteolytic cleavage by furin-like endopeptidase11,12,13. Those different peptides (a 5-mer and 11-mer) have not been isolated endogenously to date. However, the rat 11-mer sequence (named brain excitatory peptide, BEP) significantly induced synaptic excitability and possessed some dopaminergic activities in vitro (thus named dopamine neuron stimulating peptides, DNSP)13. Furthermore, the human 11-mer sequence (named DNSP-11) exhibits neurotrophic-like properties13.

Thus, the role of the full proDomain of GDNF, which is a product of proteolytic cleavage of proGDNF, is not clearly understood yet.

Net Peptide Content: 100%
Lyophilized Powder
Back to product pageSDSNew Generate a Quote
Last update: 11/04/2021

See Related Products

For research purposes only, not for human use

Specifications

Applications

Scientific Background

Citations

Citations
Shipping and Ordering information
    Back to product pageSDSNew Generate a Quote

    Free International Shipping

    Products are lyophilized and ship at room temperature - FREE OF CHARGE.

    We ship worldwide within 24 hours of our next business day.

    For more country-specific shipping and contact information see Ordering & Shipping.


    Free Sample Program

    Not sure whether the product fits your experimental setup?

    Try it first!


    Alomone Guarantee

    We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

    Alomone Guarantee information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us

    Contact Us

    © 2021 Alomone Labs. All Rights Reserved.

    Terms of Service Privacy Policy
    Scroll to top