Recombinant human Pleiotrophin protein

PTN
Human Pleiotrophin, Recombinant, E. coli
Cat #: P-150
Alternative Name PTN
  • Lyophilized Powder
  • Bioassay Tested
  • Sterile & Endotoxin Free
  • Origin Recombinant, E. coli
    MW: 15.4 kDa.
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity: >98% (HPLC)
    Form Lyophilized from a 0.2 µm filtered solution.
    Effective concentration EC50 = ~0.65-6.5 pM.
    Sequence MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD.
    Activity Pleiotrophin is a member of the heparin-binding neurotrophic factor family. It is a developmentally regulated neurotrophic factor which promotes neurite outgrowth, axonal guidance and synaptogenesis1-4.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Sterile water at a concentration of at least 1 µg/0.1 ml.
    BSA (0.1 mg/ml) should be added for more diluted solutions. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
      • The activity was determined by the ability to enhance neurite outgrowth of cerebral cortical neurons of E10 chick embryos.
      • Pleiotrophin (PTN), is a heparin-binding neurotrophic factor. Cells that express either PTN or PTN mRNA include osteoblasts, fetal chondrocytes,1 astrocytes, oligodendroglia, neurons,2 Schwann cells,3 keratinocytes of the stratum basale,3 and selected tumor cell lines.4,5 The expression of PTN increases during the process of brain embryogenesis and reaches maximum levels at time of birth.

        The role of PTN in neurogenesis and neural plasticity has been revealed by various studies. Embryonic cortical neurons adhere to and extend neurites on PTN coated substratum.6 PTN also induces, in vitro, migration of osteoblasts. 7 PTN coated membrane enhances neuronal migration by haptotaxis.8 PTN bound to agarose beads induces clustering of acetylcholine receptors on embryonic myoblasts.9

        PTN is expressed in the CA1 region of rat hippocampus in an activity-dependent manner, and is suggested to be involved in the regulation of synaptic plasticity in the hippocampus.10

        Transfection with PTN cDNA, transforms murine 3T3 fibroblasts into cells that form extensively metastasizing tumors in nude mice.11 PTN is highly expressed in choriocarcinoma, melanoma and, prostate carcinoma. Serum PTN increase in patients with pancreatic and colon carcinomas.12

        After focal forebrain ischemia, PTN is expressed in astrocytes, OX-42 positive macrophages, and endothelial cells in areas of developing neovascularization.13 PTN is also deposited in senile plaques in Alzheimer's disease and Down's syndrome.14

    Net Peptide Content: 100%
    Last update: 01/07/2019

    Recombinant human Pleiotrophin protein (#P-150) is a highly pure, recombinant, and biologically active protein.

    For research purposes only, not for human use
    Citations
    Related Products