Free shipping starts now, no minimum, no coupons required!
Home › Products › Neurotrophic Factors and Receptors › Pro-Neurotrophins › Biotinylated Pro-Neurotrophins

human proBDNF-Biotin

Human proBrain-Derived Neurotrophic Factor Conjugated to Biotin

Cat #: B-256-B
Lyophilized Powder yes
  • Bioassay Tested
    • Origin Recombinant, E. coli
    MW: 51 kDa
    Purity: >98%
    Form Lyophilized powder.
    Effective concentration 0.1-10 nM.
    Sequence MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVAGHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR (shown in bold is the prodomain, underlined are the double point mutations preventing cleavage).
    Modifications LC-Biotin.
    Structure
    Activity BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8. proBDNF has been shown to be a pro-apoptotic ligand for sympathetic neurons9 expressing both p75 and sortilin, and to be involved in LTD10.
    References-Activity
    1. Tolkovsky, A. (1997) Trends Neurosci. 20, 1.
    2. Jing, S. et al. (1992) Neuron 9, 1067.
    3. Acheson, A. et al. (1995) Nature 374, 450.
    4. Morse, J.K. et al. (1993) J. Neurosci. 13, 4146.
    5. Hyman, C. et al. (1991) Nature 350, 230.
    6. Friedman, B. et al. (1995) J. Neurosci. 15, 1044.
    7. Meyer, M. et al. (1992) J. Cell Biol. 119, 45.
    8. Koliatsos, V.E. et al. (1993) Neuron 10, 359.
    9. Teng, H.K. et al. (2005) J. Neurosci. 25, 5455.
    10. Woo, N.H. et al. (2005) Nat. Neurosci. 8, 1069.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility The product is lyophilized in a conical vial containing maximum volume of 0.5 ml. Reconstitute in any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs human proBDNF-Biotin induces phosphorylation of ERK1/2 (p42/44 MAPK) in TrkB-expressing HEK 293 cells.
      Alomone Labs human proBDNF-Biotin induces phosphorylation of ERK1/2 (p42/44 MAPK) in TrkB-expressing HEK 293 cells.
      Cells were stimulated with 0, 2, 10 and 50 ng/ml human proBDNF-biotin (#B-256-B) and with 50 ng/ml Recombinant human proBDNF (cleavage resistant) protein (#B-256), as indicated. Cell proteins were resolved by SDS-PAGE and probed with anti-phospho-ERK1/2.
    References - Scientific background
    1. Bibel, M. and Barde, Y.A. (2000) Genes Dev. 14, 2929.
    2. Cahoon-Metzger, S.M. et al. (2001) Dev. Biol. 232, 246.
    3. Troy, C.M. et al. (2002) J. Biol. Chem. 277, 34295.
    4. Chen, Z.Y. et al. (2004) J. Neurosci. 24, 4401.
    5. Egan, M.F. et al. (2003) Cell 112, 257.
    6. Lee, R. et al. (2001) Science 294, 1945.
    7. Teng, H.K. et al. (2005) J. Neurosci. 25, 5455.
    8. Woo, N.H. et al. (2005) Nat. Neurosci. 8, 1069.
    9. Fayard, B. et al. (2005) J. Neurosci. Res. 80, 18.
    10. Michalski, B. et al. (2003) Mol. Brain Res. 111, 148.
    11. Zhou, X.F. et al. (2004) J. Neurochem. 91, 704.
    Scientific background

    BDNF is a neurotrophic factor produced by proteolytic cleavage of its precursor, proBDNF.1 The actions of BDNF are mediated via the binding to TrkB or p75NTR.2,3

    The precursor form was thought to be important for the correct folding, secretion and trafficking of the mature protein. A single-nucleotide polymorphism (Val66 to Met) in the pro-domain of the human BDNF gene impairs intracellular trafficking and regulated secretion of BDNF in primary cortical neurons and neurosecretory cells but not in endothelial and vascular cells.4 This has been shown to affect memory and lead to abnormal hippocampal function in humans.5

    The finding that proBDNF and not mature BDNF is the preferred ligand for p75NTR, has ushered in a new era which reexamines the biological roles of the two forms.6 Some biological roles for proBDNF have been proposed: It has been shown to be a pro-apoptotic ligand for sympathetic neurons7 expressing both p75NTR and sortilin, and to be involved in LTD8. On the other hand, it has also been shown to elicit prototypical TrkB responses in biological assays, such as TrkB tyrosine phosphorylation, and activation of ERK1/2.9

    In brain homogenates a mixture of both, proBDNF and mature BDNF has been found10,11 and in cortical neurons secretion of proBDNF has been shown.7 Binding of both proBDNF and mature BDNF to TrkB has been proposed to be via the R103 residue in the mature portion.9

    Peptide Content: 100%
    Lyophilized Powder
    Image & Title


    Alomone Labs human proBDNF-biotin retrograde transport in motor neuron axons.Quantum-dot conjugated to human proBDNF-Biotin (#B-256-B) (0.25 µg/ml), was added to the distal side of spinal cord explants grown for few days in microfluidic chamber, followed by axonal live imaging using a spinning disc confocal microscope.

    Last update: 13/10/2022

    With the many roles allotted to proBDNF, we have developed a novel tool for studying and visualizing the protein in living cells. human proBDNF-Biotin (#B-256-B) is highly purified Recombinant human proBDNF (cleavage resistant) protein (#B-256), conjugated to biotin.

    See Related Products

    For research purposes only, not for human use
    Shipping and Ordering information

    Need Help With This Product?

    Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

    Call us at
    +972 2587 2202 or Email Us