Recombinant human proBDNF (cleavage resistant) protein

proBrain-Derived Neurotrophic Factor
Human proBrain-Derived Neurotrophic Factor (cleavage resistant), Recombinant, E. coli
    Cat #: B-256
    Alternative Name proBrain-Derived Neurotrophic Factor
  • Lyophilized Powder
  • Bioassay Tested
  • Sterile & Endotoxin Free
  • Origin Recombinant, E. coli
    MW: 51.45 kDa.
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity: >98% (HPLC)
    Form Lyophilized from a 0.2 µm filtered solution.
    Effective concentration 0.1-10 nM.
    Sequence MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVAGHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR (shown in bold is the prodomain, underlined are the double point mutations preventing cleavage).
      • Recombinant human proBDNF (cleavage resistant) protein
    Activity BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8. proBDNF has been shown to be a pro-apoptotic ligand for sympathetic neurons9 expressing both p75 and sortilin, and to be involved in LTD10.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Sterile water at a concentration of at least 10 µg/ml. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
      • Recombinant human proBDNF (cleavage resistant) protein
        Alomone Labs Recombinant human proBDNF (cleavage resistant) protein mediates neurites outgrowth in TrkB transfected PC12 cells.
        Cells were transiently transfected with TrkB/pcDNA3 containing the green fluorescence protein (GFP) as a reporter. One day post transfection, the cells were stimulated with 20 ng/ml Recombinant human proBDNF (cleavage resistant) protein (#B-256) or 10ng/ml Recombinant human BDNF protein (#B-250). Development of neurites was visualized after 6 days using bright light microscopy.
        Recombinant human proBDNF (cleavage resistant) protein
        Alomone Labs Recombinant human proBDNF (cleavage resistant) protein activates ERK1/2 MAPK in TrkB transfected HEK 293 cells.
        HEK 293 cells stably expressing TrkB receptor were serum-starved for 2h and then challenged for 10 min in the presence or absence of Recombinant human proBDNF (cleavage resistant) protein (#B-256), Recombinant human proBDNF protein (#B-257), Recombinant mouse proBDNF (cleavage resistant) protein (#B-243) or Recombinant human BDNF protein (#B-250). Cell proteins were resolved by SDS PAGE and the level of ERK1/2 phosphorylation determined using anti-phosphoERK.
    References - Scientific background
      • BDNF is a neurotrophic factor produced by proteolytic cleavage of its precursor, proBDNF.1 The actions of BDNF are mediated via the binding to TrkB or p75.2,3

        The precursor form was thought to be important for the correct folding, secretion and trafficking of the mature protein. A single-nucleotide polymorphism (Val66 to Met) in the pro-domain of the human BDNF gene impairs intracellular trafficking and regulated secretion of BDNF in primary cortical neurons and neurosecretory cells but not in endothelial and vascular cells.4 This has been shown to affect memory and lead to abnormal hippocampal function in humans.5

        The finding that proBDNF and not mature BDNF is the preferred ligand for p75, has ushered in a new era which reexamines the biological roles of the two forms.6 Some biological roles for proBDNF have been proposed: It has been shown to be a pro-apoptotic ligand for sympathetic neurons7 expressing both p75 and sortlin, and to be involved in LTD8. On the other hand, it has also been shown to elicit prototypical TrkB responses in biological assays, such as TrkB tyrosine phosphorylation, and activation of ERK1/2.9

        In brain homogenates a mixture of both, proBDNF and mature BDNF has been found10,11 and in cortical neurons secretion of proBDNF has been shown.7 Binding of both proBDNF and mature BDNF to TrkB has been proposed to be via the R103 residue in the mature portion.9

    Net Peptide Content: 100%
    Last update: 02/10/2019

    Recombinant human proBDNF (cleavage resistant) protein (#B-256) is a highly pure, recombinant, and biologically active protein.

    For research purposes only, not for human use