Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 
Alomone Labs Alomone Labs

Order Summary

Home

main

    • column
      • Ion Channels
    • column
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
    • column
      • Cell Imaging Tools
      • Research Areas
  • Home
  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • Protocols
      • FAQs and Troubleshooting
      • Citations Search Tool
    • column
      • Blog
      • Articles
      • Download Protocol Book
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
      • Subscribe – Printed Magazines
Return to Content
Home › Products › Neurotrophic Factors and Receptors › Nerve Growth Factor (NGF) › Proteins

Certificate of Analysis

Recombinant human proNGF (cleavage resistant) protein

proNerve Growth Factor

Human proNerve Growth Factor, Recombinant, E. coli

Cat #: N-285
Alternative Name proNerve Growth Factor
Lyophilized Powder yes
  • Bioassay Tested

    Every lot is tried & tested in a relevant biological assay.
    Our Bioassay

  • Sterile & Endotoxin Free yes
    Origin Recombinant, E. coli
    MW: 50 kDa
    Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
    Purity: >98% (HPLC)
    Form Lyophilized from a 0.2 µm filtered solution.
    Effective concentration 0.4 - 4 nM.
    Sequence MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSAASSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA (shown in bold is the prodomain, underlined are the double point mutations preventing cleavage).
    Structure
    Activity proNGF is the preferred ligand of p75NTR 1. In contrast to its mature form proNGF induces apoptosis via p75NTR 1, but can also mediate cell survival in DRGs2.
    References-Activity
    1. Lee, R. et al. (2001) Science 294, 1945.
    2. Rattenholl, A. et al. (2001) Eur. J. Biochem. 268, 3296.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Sterile water, DMEM at a concentration of at least 10 µg/ml. Centrifuge all product preparations before use (10000 x g 5 min). Repeated freezing/thawing might result in loss of activity.
    Storage of solutions Up to one week at 4°C or four-six weeks at -70°C.
    Our bioassay
    • Alomone Labs Recombinant human proNGF (cleavage resistant) protein does not promote survival of PC12 cells.
      Alomone Labs Recombinant human proNGF (cleavage resistant) protein does not promote survival of PC12 cells.
      Cells were grown in the absence of serum and collagen, and in the presence of varying concentrations of Recombinant human proNGF (cleavage resistant) protein (#N-285). Cell survival relative to the control was measured by the XTT method, and plotted against Recombinant human proNGF (cleavage resistant) protein concentration.
    • Alomone Labs Recombinant human proNGF (cleavage resistant) protein promotes neurite outgrowth in PC12 cells.
      Alomone Labs Recombinant human proNGF (cleavage resistant) protein promotes neurite outgrowth in PC12 cells.
      Cells were grown on collagen-coated 24 well plates in DMEM medium supplemented with 6% fetal calf serum and 6% horse serum for 24 h. Recombinant human proNGF (cleavage resistant) protein (#N-285) was added at the indicated concentration. The culture media was changed every 2-3 days. The development of neurites over a period of 5 days was visualized by Methylene Blue staining.
    Scientific background

    The proneurotrophins (proNT) are, as their name suggests, the proform of the neurotrophins. The neurotrophins (NT) are a family of soluble, basic growth factors which regulate neuronal development, maintenance, survival and death in the CNS and the PNS.1 They exert their biological effects by binding to two types of receptors: the Trk receptors, and the p75NTR receptor.

    Like many other proteins, mature NT arise from the proteolytic cleavage of the precursor form by various proteases: plasmin, furin, MP7, PC1/3, PC2, PC5/6, PC7 and PACE4, which cut behind a pair or even a single basic residue.2 This has been known for many years, and it was thought that the roles of the prodomain were to aid in the folding of the mature protein and to sort the mature neurotrophin into the various secretion pathways.3 However, recently an assortment of papers have been published which suggest new roles for the proNT. It has been found that proNerve Growth Factor (proNGF), and not mature NGF, is the predominant isoform found in the human brain as well as in a variety of cell types, including mast cells, sciatic nerve cells, thyroid gland, skeletal muscle, prostate gland, hippocampus and hair follicle.4 Thus, the case of the mouse salivary gland, which is the most abundant source of mature NGF, seems to be the exception and not the rule.

    proNGF is the ligand preferred by p75NTR.5 Therefore, cleavage resistant proNGF (mutated at the cleavage site to insure that it retains the prodomain) induced apoptosis ten times more effectively than mature NGF in a vascular smooth muscle cell line expressing p75NTR but not Trk receptors.5 However, proNGF can also mediate survival. Rattenholl et al. have shown that proNGF was as effective as NGF in inducing survival of DRG neurons.3 Fahnestock et al. have shown that a mutated proNGF exhibits neurite outgrowth on both PC12 cells and mouse sympathetic cervical ganglions.6

    A neccesary but not sufficient partner for proNGF is sortilin, a 95 kDa member of the Vps10p domain receptor family which is expressed in a variety of tissues, notably brain, spinal tissue and muscle. However, not all cells expressing p75NTR and sortilin react to proNGF by becoming apoptotic. For example, in mature pig oligodendrocytes, which express p75NTR and sortilin, proNGF induces survival.7

    A close analysis of the literature shows that there are at least four types of proNGF which have been used in biological assays. One, produced in mammalian cell culture, contains two mutations at the furin cleavage site, two mutations at the C-terminus, and the addition of a C-terminal His tag.5 A second proNGF, produced in baculovirus, has only one mutation, at the cleavage site.6 A third proNGF has been purified from the brains of Alzheimer’s patients, and is highly glycosylated.8 A fourth, with no mutations, has been expressed and purified from E.coli.3 The large variation between results obtained may be due to the different types of preparations assayed. Another crucial issue is the cell type and origin. Even in cells of the same type, for example, in oligodendrocytes: opposing effects of proNGF were seen in rat oligodendrocytes where it caused apoptosis,9 however, in pig oligodendrocytes it induced survival.7 It should be noted that rat and pig oligodendrocytes do not express the same panel of receptors: rat oligodendrocytes do not express TrkA whereas pig (and human) oligodendrocytes do.

    Peptide Content: 100%
    Lyophilized Powder
    Back to product pageSDSNew Generate a Quote
    Last update: 10/11/2022

    See Related Products

    For research purposes only, not for human use

    Specifications

    Citations

    Citations

    Applications

    Scientific Background

    Shipping and Ordering information
      Back to product pageSDSNew Generate a Quote

      Resources

      • proNGF and proBDNF: The Alter Egos

      Free International Shipping

      Products are lyophilized and ship at room temperature - FREE OF CHARGE.

      We ship worldwide within 24 hours of our next business day.

      For more country-specific shipping and contact information see Ordering & Shipping.


      Free Sample Program

      Not sure whether the product fits your experimental setup?

      Try it first!


      Alomone Guarantee

      We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

      Alomone Guarantee information

      Resources

      • proNGF and proBDNF: The Alter Egos

      Need Help With This Product?

      Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

      Call us at
      +972 2587 2202 or Email Us

      Contact Us

      © 2023 Alomone Labs. All Rights Reserved.

      Terms of Service Privacy Policy
      Scroll to top

      Bulk / Customized order