Free shipping starts now, no minimum, no coupons required!

Huwentoxin-XVI

HWTX-XVI
A Potent and Reversible Blocker of CaV2.2 Channels
Cat #: STH-105
Alternative Name HWTX-XVI
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 4437 Da.
    Purity: >98% (HPLC)
    Form Lyophilized powder.
    Effective concentration 1-10 µM
    Sequence CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK
    Modifications Disulfide bonds between Cys1-Cys16, Cys8-Cys21 and Cys15-Cys36.
    Structure
    Molecular formula C196H292N50O56S6
    CAS No.: 1600543-88-1
    Activity Huwentoxin-XVI is a potent and reversible N-type Ca2+ channel blocker1.
    References-Activity
    1. Deng, M. et al. (2014) Neuropharmacology 79, 657.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Soluble in DDW. Centrifuge all products before use (10000 x g 5 min).
    Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing.
    Our bioassay
    • Alomone Labs Huwentoxin-XVI inhibits the current of CaV2.2 channels expressed in Xenopus oocytes.
      Alomone Labs Huwentoxin-XVI inhibits the current of CaV2.2 channels expressed in Xenopus oocytes.
      A. Representative time course of Huwentoxin-XVI (#STH-105) inhibition of CaV2.2 (α1B + α2δ1 + β1) channel peak current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +60 mV every 10 sec, and inhibited by 7.5 µM Huwentoxin-XVI (green). B. Superimposed traces of CaV2.2 currents after application of control (black) and of 7.5 µM Huwentoxin-XVI (green), taken from the recording in A.
    References - Scientific background
    1. Liang, S. (2004) Toxicon 43, 575
    2. Deng, M. et al. (2014) Neuropharmacology 79, 657.
    Scientific background

    Huwentoxin XVI (HWTX-XVI) is a peptide toxin originally isolated from the Chinese bird spider Selenocosmia huwena venom1.

    Huwentoxin-XVI is a specific blocker of N-type (CaV2.2) Ca2+ channels. It has no effect on voltage-gated T-type Ca2+ channels, K+ channels or Na+ channels.

    Treatment with this toxin was shown to almost completely block the twitch response of rats in response to low-frequency electrical stimulation and to elicit significant analgesic responses to formalin-induced inflammation pain, In addition it has been shown to have higher reversibility rate than other known Ca2+ channels blockers. These findings suggest that HWTX-XVI could be a novel potential analgesic agent with high potency and low side effects2.

    Target N-type Ca2+ channels
    Net Peptide Content: 100%

    Check out more of our new products.

    Last update: 23/08/2020

    Huwentoxin-XVI (#STH-105) is a highly pure, synthetic, and biologically peptide toxin.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Shipping and Ordering information