Name: Jingzhaotoxin-34
Brand: Alomone Labs
SKU: STJ-500

Cat #: STJ-500

Alternative Name Mu-theraphotoxin-Cg1a, Mu-TRTX-Cg1a, JZTX-34, Peptide F6-25.51

Lyophilized Powder yes

Bioassay Tested

Origin Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)

Source Synthetic peptide

MW: 4150.7 Da

Purity: >98% (HPLC)

Form Lyophilized Powder

Effective concentration 0.5 µM

Sequence ACREWLGGCSKDADCCAHLECRKKWPYHCVWDWTV-OH

Modifications Disulfide bonds location - Cys^2-16, Cys^9-21and Cys^15-29

Structure

Molecular formula C₁₈₂H₂₅₈N₅₂O₄₉S₆

Activity Potent and selective inhibitor of hNa_v1.7 and weak blocker of Na_v1.3. JZTX-34 shows analgesic activity in rodent pain models¹. In addition, this toxin inhibits voltage-gated potassium channels (K_v) in rat DRG neurons¹.

References-Activity

Zeng, X. et al. (2018) Toxins, 10, 64.

Accession number B1P1F7

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Protect from light and moisture.

Solubility Centrifuge all products before use (10000 x, g 5 min). Soluble in water. It is recommended to prepare fresh solutions in working buffers before use, or aliquot stock solutions reconstituted in distilled water and keep at -20°C. Upon use, dilute the stock solution in the desired working buffer. Prevent repeated thawing and freezing cycles.

Storage of solutions Store up to one week at 4°C or up to 6 months at -20°C

Our bioassay

Alomone Labs Jingzhaotoxin-34 inhibits Na_V1.7 channel currents heterologously expressed in Xenopus oocytes.
A. Representative time course of Jingzhaotoxin-34 (#STJ-500) inhibition of Na_V1.7 channels current. Membrane potential was held at -80 mV, current was elicited by a 100 ms voltage step to 0 mV every 10 sec, and significantly inhibited by application of 0.5 µM Jingzhaotoxin-34 (green).
B. Superimposed traces of Na_V1.7 channel currents in the absence (control) and presence (green) of 0.5 µM Jingzhaotoxin-34 (taken from the recording in A).

References - Scientific background

Chen, J. et al. (2008) Cell. Mol. Life Sci., 65, 2431.
Chen J. et al. (2009) Peptides, 30, 1042.
Zeng, X. et al. (2018) Toxins, 10, 64.
Laedermann, C.J. et al. (2015) Front. Pharmacol., 6, 263.

Scientific background

Jingzhaotoxin-34 (JZTX-34) is a 35 amino acid peptidyl toxin originally isolated from the venom of the Chinese earth tiger tarantula, Chilobrachys guangxiensis^1,2. JZTX-34 is a potent and selective blocker of the voltage-gated sodium (Na_V) 1.7 channel and a weak blocker of the Na_v1.3 channel. In addition, this toxin inhibited voltage-gated potassium (K_v) channels in rat DRG neurons³.

Na_v channels are transmembrane proteins that control the voltage-dependent increase in sodium permeability. They play a fundamental role in normal neurological function, especially in the initiation and propagation of action potentials. Na_v channels are composed of nine different isoforms with distinct biophysical properties. Several studies, including the analysis of mutations associated with an increase or absence of pain sensitivity in humans, have revealed that Na_v1.7, Na_v1.8, and Na_v1.9 are the most important contributors that control nociceptive neuronal electrogenesis⁴. JZTX-34 exhibited analgesic activity in three rodent pain models³.

Target Nav1.7

Peptide Content: 100%

Lyophilized Powder

Last update: 02/01/2022

Jingzhaotoxin-34 (#STJ-500) is a highly pure, synthetic, and biologically active peptide toxin.

Order Summary

Jingzhaotoxin-34

Applications

Citations

Specifications

Scientific Background

Related Products

Need Help With This Product?