Free shipping starts now, no minimum, no coupons required!

Certificate of Analysis

K+ Channel Antibodies for Pain Research Explorer Kit

A Screening Package of K+ Channel Antibodies for Pain Research Economically Priced

Cat #: AK-390
Size: 13 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KCNN1 (KCa2.1, SK1) Antibody Cat #: APC-039

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: M, R
Immunogen
Peptide (C)DRPGSGKPPTVSHRLGHRR corresponding to amino acid residues 75-93 of rat KCNN1 (Accession P70606). Intracellular, N-terminal part.
Homology
Mouse - 17/19 amino acid residues identical; human - 12/19 amino acid residues identical.

Anti-GIRK1 (Kir3.1) Antibody Cat #: APC-005

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence LQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKMNSDRFT, corresponding to residues 437-501 of mouse GIRK1 (Accession P63250). Intracellular, C-terminus.
Homology
Rat - identical; human - 64/66 amino acid residues identical; guinea pig - 63/66 amino acid residues identical; chicken - 59/66 amino acid residues identical.

Mouse Anti-GIRK1 (Kir3.1) (extracellular) Antibody Cat #: ALM-031

Size: 25 µg Host: Mouse Type: Monoclonal Application: IC, IF, LCI, WB Reactivity: H, M
Immunogen
Synthetic peptide mapping to the extracellular loop of human GIRK1 (Accession P48549).

Anti-GIRK2 (Kir3.2) Antibody Cat #: APC-006

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence ELANRAEVPLSWSVS SKLNQHAELETEEEEKNPEELTERNG, corresponding to residues 374-414 of mouse Kir3.2 (Accession P48542). Intracellular, C-terminal part.
Homology
Rat - 40/41 amino acid residues identical; golden hamster - 39/41 amino acid residues identical; human - 37/41 amino acid residues identical.

Anti-KCNK2 (TREK-1) Antibody Cat #: APC-047

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide DPKSAAQNSKPRLSFSTK(C), corresponding to residues 8-25 of human KCNK2 (Accession O95069). Intracellular, N-terminus.
Homology
Rat - identical; mouse - 17/18 amino acid residues identical.

Guinea pig Anti-KCNK2 (TREK-1) Antibody Cat #: AGP-049

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide DPKSAAQNSKPRLSFSTK(C), corresponding to residues 8-25 of human KCNK2 (Accession O95069). Intracellular, N-terminus.
Homology
Rat - identical; mouse - 17/18 amino acid residues identical.

Anti-KCNK3 (TASK-1) Antibody Cat #: APC-024

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, R
Immunogen
Peptide (C)EDEKRDAEHRALLTRNGQ, corresponding to amino acid residues 252-269 of human KCNK3 (Accession O14649). Intracellular, C-terminal part.
Homology
Rat, mouse - 17/18 amino acid residues identical. Homology with human TASK-3: 11/17 amino acid residues identical.

Anti-KV1.1 (KCNA1) Antibody Cat #: APC-009

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse KV1.1 (Accession P16388). Intracellular, C-terminus.
Homology
Rat - 78/80 amino acid residues identical; human - 76/80 amino acid residues identical; Xenopus Laevis - 70/80 amino acid residues identical.

Anti-KV1.1 (KCNA1) (extracellular) Antibody Cat #: APC-161

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, LCI, WB Reactivity: H, M, R
Immunogen
Peptide (C)KDDKDFTGTIHRID, corresponding to amino acid residues 193-206 of rat KV1.1 (Accession P10499). 1st  extracellular loop.
Homology
Mouse - identical; human - 13/14 amino acid residues identical.

Anti-KV4.2 Antibody Cat #: APC-023

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)SNQLQSSEDEPAFVSK, corresponding to amino acid residues 454-469 of rat KV4.2 (Accession Q63881). Intracellular, C-terminus.
Homology
Mouse, human - 15/16 amino acid residues identical.

Guinea pig Anti-KV4.2 Antibody Cat #: AGP-038

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)SNQLQSSEDEPAFVSK, corresponding to amino acid residues 454-469 of rat KV4.2 (Accession Q63881). Intracellular, C-terminus.
Homology
Mouse, human - 15/16 amino acid residues identical.

Anti-KCNQ3 Antibody Cat #: APC-051

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: M, R
Immunogen
Peptide AEGEKKEDNRYSDLKTIIC, corresponding to amino acid residues 668-686 of rat KCNQ3 (Accession O88944). Intracellular, C-terminal.
Homology
Mouse - identical; human - 18/19 amino acid residues identical.

Anti-KCNQ2 Antibody Cat #: APC-050

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)RGPTITDKDRTKGPAE, corresponding to amino acid residues 578-593 of rat KCNQ2 (Accession O88943). Intracellular, C-terminus.
Homology
Mouse - identical; human - 15/16 amino acid residues identical.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

Note
A mouse monoclonal antibody (#ALM-031) and guinea pig polyclonal antibodies (#AGP-038 & #AGP-049) are included in this Explorer Kit. Please take into account when reacting with a secondary antibody.
For research purposes only, not for human use
Shipping and Ordering information