Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 
Alomone Labs Alomone Labs

Order Summary

Sign In

Forgot your password?

New customer? Create an account
Home

main

    • column
      • Ion Channels
    • column
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
    • column
      • Cell Imaging Tools
      • Research Areas
  • Home
  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Kits & Packs
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
    • column
      • Guinea Pig Polyclonal Antibodies
      • Immuno-Colocalization Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • News & Updates
    • column
      • Magazines
      • Featured Papers
    • column
      • Immuno-Colocalization Updates
      • Live Cell Imaging Updates
  • Service & Support
    • column
      • Service & Support
      • Ordering & Shipping
      • Free Sample Program
    • column
      • Protocols
      • FAQs
      • Alomone Guarantee
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
      • Subscribe – Printed Magazines
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Certificate of Analysis

Kaliotoxin-1
In wishlist

K+ channel toxin α-KTx 3.1, KTX-1
A Powerful Blocker of KCa1.1 and certain KV1 Channels
    Cat #: STK-370
    Alternative Name K+ channel toxin α-KTx 3.1, KTX-1
  • Lyophilized Powder
    Lyophilized Powder

    This product is freeze dried. All water molecules have been removed.

  • Bioassay Tested
    Bioassay Tested

    Every lot is tried & tested in a relevant biological assay.
    Our Bioassay

    • Origin Synthetic peptide
    MW: 4150 Da.
    Purity: >98% (HPLC)
    Effective concentration 10-100 nM.
    Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK.
    Modifications Disulfide bonds between Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35. Lys38 - C-terminal amidation.
    Structure
    • Kaliotoxin-1
    Molecular formula C171H284N56O48S6.
    CAS No.: 145199-73-1.
    Activity Kaliotoxin-1 is a potent inhibitor of large conductance Ca2+-activated K+ channels (BKCa)1,2. Kaliotoxin-1 also binds the dendrotoxin sensitive voltage-dependent K+ channels (KV1.1, KV1.2 and KV1.3 nM)3.
    References-Activity
    1. Crest, M. et al. (1992) J. Biol. Chem. 267, 1640.
    2. Romi, R. et al. (1993) J. Biol. Chem. 268, 26302.
    3. Mourre, C. et al. (1999) J. Pharmcol. Exp. Ther. 291, 943.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
    Our bioassay
    • Kaliotoxin-1
      Alomone Labs Kaliotoxin-1 inhibits KV1.3 channels heterologously expressed in Xenopus oocytes.
      Currents were elicited by application of voltage ramp from a holding potential of -80 mV to 50 mV in 100 msec, delivered every 10 seconds. A. Time course of channel activity (current amplitude at 0 mV), before (black) and during (green) application of 1 nM Kaliotoxin-1 (#STK-370). B. Top, illustration of the voltage ramp protocol. Bottom, example of superimposed current traces before (black) and during (green) application of 1 nM Kaliotoxin-1, taken from the experiment in A.
    Scientific background

    Kaliotoxin-1 is a 38 amino acid long toxin, originally isolated from the venom of Androctonus mauretanicus mauretanicus scorpion and is classified as α-KTX 3.1 scorpion toxin family, having three disulfide bridges1,2.

    Kaliotoxin-1 is a potent inhibitor of large conductance Ca2+-activated K+ channels (BKCa)3, and it also binds and inhibits Dendrotoxin-sensitive voltage-dependent K+ channels, mainly KV1.1 (KCNA1), KV1.2 (KCNA2) and KV1.3 (KCNA3) with a Kd of 1.5, 25 and 0.1 nM, respectively4-6. Its binding affinity to rat brain synaptosomes is 5-fold higher than that of Kaliotoxin-37.

    The 3D structure of Kaliotoxin was determined by NMR spectroscopy and showed significant differences from structures established for other related scorpion toxins8,9.

    In vivo application of Kaliotoxin was shown to facilitate cognitive processes such as learning in rats10.

    Target KCa1.1 and some KV1 K+ channels
    Net Peptide Content: 100%
    Lyophilized Powder
    Back to product page
    Last update: 24/01/2020
    For research purposes only, not for human use

    Specifications

    Applications

    Scientific Background

    Citations

    Citations
    Shipping and Ordering information
    In Stock
    Size
    Bulk order
    Qty
    Price (USD):
      Back to product page

      Files

      • SDS

      Resources

      • KV1.3 Channels

      Shipping Information

      Products are lyophilized and ship at room temperature.

      We ship worldwide within 24 hours of our next business day.

      For more country-specific shipping and contact information see Ordering & Shipping.

      Free Sample Program

      Not sure whether the product fits your experimental setup?

      Try it first!

      Alomone Guarantee

      We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

      Alomone Guarantee information

      Resources

      KV1.3 Channels

      Need Help With This Product?

      Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

      Call us at
      +972 2587 2202 or Email Us

      Contact Us

      © 2020 Alomone Labs. All Rights Reserved.

      Terms of Service Privacy Policy
      Scroll to top