Name: Kaliotoxin-1
Brand: Alomone Labs
SKU: STK-370

Cat #: STK-370

Alternative Name K⁺channel toxin α-KTx 3.1, KTX-1

Lyophilized Powder yes

Bioassay Tested

Origin Synthetic peptide

MW: 4150 Da

Purity: >98% (HPLC)

Effective concentration 10-100 nM.

Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK.

Modifications Disulfide bonds between Cys⁸-Cys²⁸, Cys¹⁴-Cys³³, and Cys¹⁸-Cys³⁵. Lys³⁸ - C-terminal amidation.

Structure

Molecular formula C₁₇₁H₂₈₄N₅₆O₄₈S₆.

CAS No.: 145199-73-1

Activity Kaliotoxin-1 is a potent inhibitor of large conductance Ca²⁺-activated K⁺ channels (BK_Ca)^1,2. Kaliotoxin-1 also binds the dendrotoxin sensitive voltage-dependent K⁺ channels (K_V1.1, K_V1.2 and K_V1.3 nM)³.

References-Activity

Crest, M. et al. (1992) J. Biol. Chem. 267, 1640.
Romi, R. et al. (1993) J. Biol. Chem. 268, 26302.
Mourre, C. et al. (1999) J. Pharmcol. Exp. Ther. 291, 943.

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

Storage of solutions Up to one week at 4°C or three months at -20°C.

Our bioassay

Alomone Labs Kaliotoxin-1 inhibits K_V1.3 channels heterologously expressed in Xenopus oocytes.
Currents were elicited by application of voltage ramp from a holding potential of -80 mV to 50 mV in 100 msec, delivered every 10 seconds. A. Time course of channel activity (current amplitude at 0 mV), before (black) and during (green) application of 1 nM Kaliotoxin-1 (#STK-370). B. Top, illustration of the voltage ramp protocol. Bottom, example of superimposed current traces before (black) and during (green) application of 1 nM Kaliotoxin-1, taken from the experiment in A.

Scientific background

Kaliotoxin-1 is a 38 amino acid long toxin, originally isolated from the venom of Androctonus mauretanicus mauretanicus scorpion and is classified as α-KTX 3.1 scorpion toxin family, having three disulfide bridges^1,2.

Kaliotoxin-1 is a potent inhibitor of large conductance Ca²⁺-activated K⁺ channels (BK_Ca)³, and it also binds and inhibits Dendrotoxin-sensitive voltage-dependent K⁺ channels, mainly K_V1.1 (KCNA1), K_V1.2 (KCNA2) and K_V1.3 (KCNA3) with a Kd of 1.5, 25 and 0.1 nM, respectively^4-6. Its binding affinity to rat brain synaptosomes is 5-fold higher than that of Kaliotoxin-3⁷.

The 3D structure of Kaliotoxin was determined by NMR spectroscopy and showed significant differences from structures established for other related scorpion toxins^8,9.

In vivo application of Kaliotoxin was shown to facilitate cognitive processes such as learning in rats¹⁰.

Target K_Ca1.1 and some K_V1 K⁺channels

Peptide Content: 100%

Lyophilized Powder

Last update: 06/11/2022

For research purposes only, not for human use

Specifications

Citations

Applications

Scientific Background

Shipping and Ordering information

Order Summary

Certificate of Analysis

Kaliotoxin-1

Specifications

Citations

Applications

Scientific Background

Resources

Need Help With This Product?