Certificate of Analysis

KV Channel Antibodies for Pain Research Explorer Kit

A Screening Package of KV Channel Antibodies for Pain Research Economically Priced
Cat #: AK-385 12 Vials

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KV1.1 (KCNA1) Antibody Cat #: APC-009

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGN
CTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse KV1.1 (Accession P16388), (MW: 36 kDa.). Intracellular, C-terminus.
Homology
Rat - 78/80 amino acid residues identical; human - 76/80 amino acid residues identical; Xenopus Laevis - 70/80 amino acid residues identical.

Anti-KV1.1 (KCNA1) (extracellular) Antibody Cat #: APC-161

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IFC, LCI, WB Reactivity: H, M, R
Immunogen
Peptide (C)KDDKDFTGTIHRID, corresponding to amino acid residues 193-206 of rat KV1.1 (Accession P10499). 1st  extracellular loop.
Homology
Mouse - identical; human - 13/14 amino acid residues identical.

Anti-KV4.2 Antibody Cat #: APC-023

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)SNQLQSSEDEPAFVSK, corresponding to amino acid residues 454-469 of rat KV4.2 (Accession Q63881). Intracellular, C-terminus.
Homology
Mouse, human - 15/16 amino acid residues identical.

Guinea pig Anti-KV4.2 Antibody Cat #: AGP-038

Size: 50 µl Source: Guinea pig Type: Polyclonal Application: IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)SNQLQSSEDEPAFVSK, corresponding to amino acid residues 454-469 of rat KV4.2 (Accession Q63881). Intracellular, C-terminus.
Homology
Mouse, human - 15/16 amino acid residues identical.

Anti-KCNQ2 Antibody Cat #: APC-050

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)RGPTITDKDRTKGPAE, corresponding to amino acid residues 578-593 of rat KCNQ2 (Accession O88943). Intracellular, C-terminus.
Homology
Mouse - identical; human - 15/16 amino acid residues identical.

Anti-KCNQ3 Antibody Cat #: APC-051

Size: 50 µl Source: Rabbit Type: Polyclonal Application: IC, IH, IP, WB Reactivity: M, R
Immunogen
Peptide AEGEKKEDNRYSDLKTIIC, corresponding to amino acid residues 668-686 of rat KCNQ3 (Accession O88944). Intracellular, C-terminal.
Homology
Mouse - identical; human - 18/19 amino acid residues identical.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

Note
A Guinea pig polyclonal antibody (#AGP-038) is included in this Explorer Kit. Please take into account when reacting with a secondary antibody.