Free shipping starts now, no minimum, no coupons required!

Certificate of Analysis

KV1.3 (KCNA3) Channel Basic Research Pack

All You Need for KV1.3 (KCNA3) Channel Research

Cat #: ESB-501
Size: 4 Vials
Form: Lyophilized

Antibodies

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KV1.3 (KCNA3) Antibody Cat #: APC-002

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human KV1.3 (Accession P22001). Intracellular, C-terminus.
Homology
Rat, rabbit, mouse - identical.

Anti-KV1.3 (KCNA3) (extracellular) Antibody Cat #: APC-101

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, LCI, WB Reactivity: H, M, R
Immunogen
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). Extracellular loop between domains S1 and S2.
Homology
Rat, mouse - 12/14 amino acid residues identical.

Pharmacological Reagents

Aa1 Toxin Cat #: RTA-400

Size: 10 µg MW: 3868 Da Purity: >98% (HPLC) Net peptide content: 100%
Origin
Recombinant, E. coli
Effective concentration
100 nM - 1 µM.
Activity
Aa1 Toxin is a blocker of A-type voltage-gated transient K+ channels of cerebellar granular cells1,2.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to one week at 4°C or three months at -20°C.

Agitoxin-2 Cat #: STA-420

Size: 0.1 mg MW: 4091 Da Purity: >98% (HPLC) Net peptide content: 100%
Origin
Synthetic peptide
Effective concentration
50 pM - 10 nM.
Activity
Agitoxin-2 is a blocker of Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to two week at 4°C or three months at -20°C.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For more information, please refer to individual certificate of analysis for each product.

For research purposes only, not for human use
Shipping and Ordering information