Certificate of Analysis

KV1.3 (KCNA3) Channel Deluxe Research Pack

All You Need for KV1.3 (KCNA3) Channel Research
Cat #: ESD-501 11 Vials


Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KV1.3 (KCNA3) Antibody Cat #: APC-002

Size: 0.2 ml Source: Rabbit Type: Polyclonal Application: IC, IH, IP, WB Reactivity: H, M, R
GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human KV1.3 (Accession P22001). Intracellular, C-terminus.
Rat, rabbit, mouse - identical.

Anti-KV1.3 (KCNA3) (extracellular) Antibody Cat #: APC-101

Size: 0.2 ml Source: Rabbit Type: Polyclonal Application: IC, IFC, IH, IP, LCI, WB Reactivity: H, M, R
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). Extracellular loop between domains S1 and S2.
Rat, mouse - 12/14 amino acid residues identical.

Anti-KV1.3 (KCNA3) (extracellular)-Biotin Antibody Cat #: APC-101-B

Size: 50 µl Source: Rabbit Type: Polyclonal Application: FC, IH, WB Reactivity: H, M, R
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). Extracellular loop between domains S1 and S2.
Rat, mouse - 12/14 amino acid residues identical.

Guinea pig Anti-KV1.3 (KCNA3) (extracellular) Antibody Cat #: AGP-005

Size: 0.2 ml Source: Guinea pig Type: Polyclonal Application: IH, WB Reactivity: H, M, R
Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human KV1.3 (Accession P22001). 1st extracellular loop.
Rat, mouse - 12/14 amino acid residues identical.

Pharmacological Reagents

Aam-KTX Cat #: STA-110

Size: 0.1 mg MW: 4185 Da. Purity: >99% (HPLC) Net peptide content: 100%
Synthetic peptide originated from Androctonus amoreuxi (African fattail scorpion).
Effective concentration
0.1-1 nM.
Aam-KTX is a KV1.3 channel blocker1.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to two weeks at 4°C or three months at -20°C.

ADWX-1 Cat #: STW-100

Size: 0.1 mg MW: 4072 Da. Purity: >98% (HPLC) Net peptide content: 100%
Synthetic peptide originated from rationally designed, highly specific KV1.3 inhibitor peptide, based on the scorpion (Mesobuthus martensii) toxin BmKTX.
Effective concentration
1 pM - 2 nM.
Selective potent KV1.3 blocker1-3.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to two weeks at 4°C or three months at -20°C.

Agitoxin-2 Cat #: STA-420

Size: 0.1 mg MW: 4091 Da. Purity: >98% (HPLC) Net peptide content: 100%
Synthetic peptide originated from Leiurus quinquestriatus hebraeus (Yellow scorpion).
Effective concentration
50 pM - 10 nM.
Agitoxin-2 is a blocker of Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to two week at 4°C or three months at -20°C.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.


Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution


Preadsorption control

1 μg peptide per 1 μg antibody.

For more information, please refer to individual certificate of analysis for each product.

A guinea pig polyclonal antibody (#AGP-005) is included in this Research Pack. Please take into account when reacting with a secondary antibody.