Certificate of Analysis

Long QT Syndrome-Related Antibody Explorer Kit

A Screening Package of Long QT Syndrome-Related Antibodies Economically Priced
Cat #: AK-350 18 Vials

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KCNE1 (IsK) Antibody Cat #: APC-163

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M, R
Immunogen
Peptide (C)RSKKLEHSHDPFN, corresponding to amino acid residues 68-80 of rat KCNE1 (Accession P15383). Intracellular, C-terminus.
Homology
Mouse, pig, dog – identical; human – 12/13 amino acid residues identical.

Anti-KCNQ1 Antibody Cat #: APC-022

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)TYEQLTVPRRGPDEGS, corresponding to amino acid residues 661-676 of human KCNQ1 (Accession P51787). Intracellular, C-terminus.
Homology
Rat, mouse - 14/16 amino acid residues identical.

Anti-KCNQ1 (extracellular) Antibody Cat #: APC-168

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, LCI, WB Reactivity: H, M, R
Immunogen
Peptide(C)EKDAVNESGRIEFG, corresponding to amino acid residues 284-297 of rat KCNQ1 (Accession Q9Z0N7). 3rd extracellular loop.
Homology
Mouse – identical; human – 13/14 amino acid residues identical.

Anti-KCNH2 (erg1) Antibody Cat #: APC-016

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (CY)EEL PAGAP ELPQD GPT, corresponding to residues 1122-1137 of rat KV11.1 (erg1) (Accession O08962). Intracellular, C-terminal part.
Homology
Mouse - identical; human, dog, rabbit - 14/16 amino acid residues identical.

Anti-KCNH2 (HERG) Antibody Cat #: APC-062

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG) (Accession Q12809). Intracellular, C-terminus.
Homology
Rabbit - identical; dog - 51/54 amino acid residues identical; mouse, rat - 50/54 amino acid residues identical.

Anti-KCNH2 (HERG) (extracellular) Antibody Cat #: APC-109

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IFC, IH, IP, LCI, WB Reactivity: H, R
Immunogen
Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG) (Accession Q12809). Extracellular, between S1 and S2 domains.
Homology
Rat, mouse - 11/16 amino acid residues identical; dog, rabbit - 15/16 amino residues identical.

Anti-NaV1.5 (SCN5A) (493-511) Antibody Cat #: ASC-005

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide DRLPKSDSEDGPRALNQLS(C), corresponding to amino acid residues 493-511 of rat NaV1.5 (accession number P15389). Intracellular loop between domains I and II.
Homology
Mouse - identical; human - 17/19 amino acid residues identical.

Guinea pig Anti-NaV1.5 (SCN5A) Antibody Cat #: AGP-008

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide DRLPKSDSEDGPRALNQLSC, corresponding to amino acid residues 493-511 of rat NaV1.5 (Accession P15389). Intracellular loop between domains I and II.
Homology
Mouse - identical; human - 17/19 amino acid residues identical.

Anti-NaV1.5 (SCN5A) (1978-2016) Antibody Cat #: ASC-013

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IFC, IH, WB Reactivity: H, R
Immunogen
GST fusion protein with amino acid residues 1978-2016 of human NaV1.5 (Accession Q14524), (MW: 33 kDa.). Intracellular, C-terminus.
Homology
Rat - 36/39 amino acid residues identical; mouse - 34/39 amino acid residues identical.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

Note
A Guinea pig polyclonal antibody (#AGP-008) is included in this Explorer Kit. Please take into account when reacting with a secondary antibody.