Lq2

K+ channel toxin α-KTx 1.2, Charybdotoxin-2, ChTX-Lq2, ChTx-d, Toxin 18-2, Lqh 18-2
A Potent Blocker of Kir1.1 (ROMK1) Channels
Cat #: RTL-550
Alternative Name K+ channel toxin α-KTx 1.2, Charybdotoxin-2, ChTX-Lq2, ChTx-d, Toxin 18-2, Lqh 18-2
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Leiurus quinquestriatus hebraeus (Yellow scorpion).
    Source Recombinant, E. coli
    MW: 4353 Da.
    Purity: >98% (HPLC)
    Effective concentration 0.1-10 nM.
    Sequence QFTQESCTASNQCWSICKRLHNTNRGKCMNKKCRCYS.
    Modifications Disulfide bonds between Cys7-Cys28, Cys13-Cys33 and Cys17-Cys35.
    Molecular formula C177H280N60O55S7.
    Activity Lq2 inhibits Kir1.1 Kinward rectifier channels2, as well as KCa channels1.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Alomone Labs Lq2 inhibits Kir1.1 (ROMK1) channels heterologously expressed in Xenopus oocytes.
        A. ROMK1 channel current (in 5 mM K+) elicited by 200 ms depolarization from a holding potential of -100 mV to +20 mV, before and during application of Lq2 (#RTL-550) at the indicated concentrations. B. Mean ±S.D. dose response for Lq2 inhibition of ROMK1 channels (n = 4-6 oocytes for each time point). The smooth line is a fit giving a Ki of 5 nM. C. Mean ± S.D. I-V relation of control and inhibited currents (n = 4).
      • Lq2 was originally isolated from Leiurus quinquestriatus hebraeus scorpion venom.1

        Lq2 blocks Kir1.1 K+ inward rectifier channels (Ki of 410 nM).2

        In the planar lipid bilayer, it also blocked single KCa channels from rat muscle with intrinsic KD of 43 nM,1 by introducing brief closures. Lq2 action is on the extracellular side of the pore.

    Target Kir1.1 K+ channels
    Net Peptide Content: 100%
    Last update: 28/05/2019

    Lq2 (#RTL-550) is a highly pure, recombinant, and biologically active peptide toxin.

    For research purposes only, not for human use
    Citations
    Related Products