mHuwentoxin-IV

mutated Huwentoxin-IV, Pyrolidone Huwentoxin-IV
A Blocker of TTX-Sensitive NaV Channels
Cat #: STH-101
Alternative Name mutated Huwentoxin-IV, Pyrolidone Huwentoxin-IV
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Haplopelma schmidti (Chinese bird spider, Ornithictonus huwenum).
    Source Synthetic peptide
    MW: 4089 Da.
    Purity: >98% (HPLC)
    Effective concentration 20-500 nM.
    Sequence ZCLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI.
    Modifications Disulfide bonds between Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31. Ile35 - C-terminal amidation. Z= Pyroglutamic acid.
    Molecular formula C174H276N52O50S6.
    Activity mHWTX-IV inhibits tetrodotoxin-sensitive NaV channels of dorsal root ganglion neurons with an IC50 nearly equal to native HWTX-IV (IC50 value of 28 nM versus 26 nM)1.
      • Xiao, Y. et al. (2008) J. Biol. Chem. 283, 27300.

    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Alomone Labs mHuwentoxin-IV inhibits NaV1.7 currents in stably transfected HEK cells.
        A. Time course of mHuwentoxin-IV (#STH-101) action on NaV1.7 currents. Maximum current amplitudes were plotted as a function of time. Membrane potential was held at –100 mV and cells were stimulated by a 50 ms voltage ramp to +20 mV. 100 nM mHuwentoxin-IV were perfused as indicated by the bar (green) during 4 min. B. Superimposed examples of NaV1.7 channel current in the absence (control) and presence (green) of 100 nM mHuwentoxin-IV (taken from the experiment in A).
      • Peng, K. et al. (2002) J. Biol. Chem. 277, 47564.
      • Xiao, Y. et al. (2008) J. Biol. Chem. 283, 27300.
      • Rong, M. et al.(2013)  PLoS ONE 8, e65984.
      • Cummins, T.R. et al. (2004) J. Neurosci. 24, 8232.
      • Huwentoxin-IV (HWTX-IV), a tetrodotoxin-sensitive (TTX-s) Na+ channel blocker, isolated from the venom of the Chinese Bird spider Ornithoctonus huwena1. A naturally modified HWTX-IV (mHWTX-IV), having a molecular mass 18 Da. lower than HWTX-IV, has also been isolated from the venom of the same spider. mHWTX-IV has been shown to have the same amino acid sequence as that of HWTX-IV, except that the N-terminal glutamic acid is replaced by pyroglutamic acid. mHWTX-IV inhibits tetrodotoxin-sensitive NaV channels of dorsal root ganglion neurons with an IC50 nearly equal to native HWTX-IV (IC50 value of 28 nM versus 26 nM). mHWTX-IV shows the same activation and inactivation kinetics seen for native HWTX-IV2.

        Huwentoxin-IV preferentially inhibits hNaV1.7. NaV1.7 plays a crucial role in pain transduction with familial gain of function mutations linked to several chronic pain disorders, while loss of NaV1.7 function results in congenital insensitivity to pain3.

    Target TTX-sensitive Na+ channels
    Net Peptide Content: 100%
    Last update: 03/03/2019

    mHuwentoxin-IV (#STH-101) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use