Free shipping starts now, no minimum, no coupons required!

mouse, rat Galanin

A Non-Selective, Potent Galanin Receptor Agonist

Cat #: GPG-100
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 3164 Da
    Purity: ≥98% (HPLC)
    Effective concentration 1-10 nM.
    Sequence GWTLNSAGYLLGPHAIDNHRSFSDKHGLT.
    Modifications C-terminal amidation.
    Structure
    Molecular formula C141H211N43O41.
    CAS No.: 114547-31-8
    Activity Galanin receptor agonist1.
    References-Activity
    1. Schmidt W.E. et al. (1991) Proc. Natl. Acad. Sci. U. S. A. 88, 11435.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Soluble in water. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to four weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs mouse, rat Galanin activates Galanin 2 receptor-mediated Ca2+ mobilization in CHO-K1-Gα16-mt Aequorin cells.
      Alomone Labs mouse, rat Galanin activates Galanin 2 receptor-mediated Ca2+ mobilization in CHO-K1-Gα16-mt Aequorin cells.
      Dose-response of normalized activation of Galanin 2 receptor-mediated Ca2+ mobilization, evoked by mouse, rat Galanin (#GPG-100). Ca2+ response was detected by measuring aequorin-derived fluorescence following application of mouse,rat Galanin at different concentrations. The EC50 measured for mouse, rat Galanin is 5.02 nM.
    References - Scientific background
    1. Schmidt W.E. et al. (1991) Proc. Natl. Acad. Sci. U. S. A. 88, 11435.
    2. Zhang, M.L. et al. (2017) Sci. Rep. 7, 45930.
    Scientific background

    Galanin is a peptide hormone that acts as a non-selective and potent galanin receptor agonist. Galanin is a C-terminally amidated 29-residue peptide (30 in humans). It was first isolated from porcine intestine1,2.

    Galanin is widely distributed throughout the central and peripheral nervous systems and its biological activity includes contraction or relaxation of gut smooth muscles, inhibition of insulin and somatostatin release, and modulation of hormone secretion from the pituitary and adrenal gland. It is believed that galanin plays an important role as a neuromodulator of endocrine secretion and synaptic transmission1.

    Galanin receptors belong to the family of G-protein coupled receptors and consist of three subtypes: GalR1, GalR2, and GalR3. Additional studies show that galanin and its receptors are involved in the transmission and modulation of nociception2.

    Target Galanin receptors
    Peptide Content: 100%
    Last update: 06/11/2022

    mouse, rat Galanin (#GPG-100) is a highly pure, synthetic, and biologically active peptide.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Shipping and Ordering information