Name: Pardaxin
Brand: Alomone Labs
SKU: P-300

Cat #: P-300

Alternative Name Pardaxin P-5, Pardaxin Pa5

Lyophilized Powder yes

Bioassay Tested

Origin Natural peptide isolated from Pardachirus marmoratus (Red sea moses sole).

MW: 3382 Da

Purity: >98% (HPLC)

Effective concentration 1-10 µM.

Sequence GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE.

Molecular formula C₁₅₆H₂₅₀N₃₆O₄₇.

CAS No.: 67995-63-5.

Activity Pardaxin forms ion channel-like structures at low concentrations and at high concentrations, causes cell membrane lysis^1,2. Pardaxin also induces neurotransmitter release from neurons^3,4.

References-Activity

Lazarovici, P. et al. (1986) J. Biol. Chem. 261, 16704.
Adermann, K. et al. (1998) FEBS Lett. 435, 173.
Abu-Raya, S. et al. (1998) J. Pharmacol. Exp. Ther. 287, 889.
Bloch-Shilderman, E. et al. (2002) J. Pharmacol. Exp. Ther. 301, 953.

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

Storage of solutions Up to one week at 4°C or three months at -20°C.

Our bioassay

The activity of this lot was tested to confirm its ability to stimulate release of catecholamines from PC12 cells according to Lazarovici, P. et al.².

Scientific background

Pardaxin is a 33 amino acid peptidyl toxin, produced by the Red Sea Moses sole fish Pardachirus marmoratus. Pardaxin is acidic, amphipathic, and hydrophobic that forms voltage-dependent pore channels in liposomes and planar lipid bilayers and living cells².

The toxin exhibits a neurotoxic, excitatory activity toward neurons at subcytotoxic concentrations by both Ca²⁺-dependent and Ca²⁺-independent mechanisms. Pardaxin also causes hemolysis, reduction of blood pressure, cell death by necrosis, and is lethal to rats at higher concentrations³.

Peptide Content: 100%

Lyophilized Powder

Last update: 13/10/2022

For research purposes only, not for human use

Specifications

Citations

Applications

Scientific Background

Shipping and Ordering information

Order Summary

Certificate of Analysis

Pardaxin

Specifications

Citations

Applications

Scientific Background

Need Help With This Product?