Free shipping starts now, no minimum, no coupons required!

Phlotoxin 1

Mu-theraphotoxin-Pspp1, Mu-TRTX-Pspp1, PhlTx1

Selective Blocker of NaV1.7

Cat #: STP-800
Alternative Name Mu-theraphotoxin-Pspp1, Mu-TRTX-Pspp1, PhlTx1
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Phlogiellus sp. (Tarantula)
    Source Synthetic
    MW: 4057.7 Da
    Purity: >98% (HPLC)
    Form Lyophilized powder
    Effective concentration 0.2-1 µM
    Sequence ACLGQWDSCDPKASKCCPNYACEWKYPWCRYKLF-NH2
    Modifications Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29
    Phe34 – C-terminal amidation
    Structure
    Molecular formula C183H254N46O48S6
    Activity A potent blocker of Nav1.7 channel1.
    References-Activity
    1. Nicolas, S. et al. (2019) Toxins 11, 367.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Soluble in DDW.
    Centrifuge all products before use (10000 x g 5 min).
    Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing.
    Our bioassay
    • Alomone Labs Phlotoxin 1 inhibits NaV1.7 channel currents heterologously expressed in Xenopus oocytes.
      Alomone Labs Phlotoxin 1 inhibits NaV1.7 channel currents heterologously expressed in Xenopus oocytes.
      A. Representative time course of Phlotoxin 1 (#STP-800) inhibition of NaV1.7 channels current. Membrane potential was held at -80 mV, current was elicited by a 100 ms voltage step to 0 mV every 10 sec, and significantly inhibited by application of 250 nM Phlotoxin 1 (green).
      B. Superimposed traces of NaV1.7 channel currents in the absence (control) and presence (green) of 250 nM Phlotoxin 1 (taken from the recording in A).
    References - Scientific background
    1. Gonçalves, T.C. et al. (2019) Toxins 11, 484.
    2. Cardoso, F.C. and Lewis, R.J. (2019) Front. Pharmacol. 10, 366.
    3. Nicolas, S. et al. (2019) Toxins 11, 367.
    4. Klint, J.K. et al. (2015) Br. J. Pharmacol. 172, 2445.
    Scientific background

    Phlotoxin 1 (PhlTx1) is a voltage-gated Na+ channel (NaV) blocker, originally isolated from the venom of a Phlogiellus genus spider endemic to Papua New Guinea.

    Phlotoxin 1, characterized by a 34-amino acids sequence with 3 disulfide bridges and structure around the inhibitory cysteine-knot (ICK) architectural motif, was shown to belong to the spider toxin NaSpTx family 11,2.

    Nav1.7 was identified as the most sensitive ion channel and main target for Phlotoxin 1 inhibition3. ­ NaV1.7 channel plays an important role in human pain signaling pathway and it is an important therapeutic target for treatment of chronic pain. Hence, Phlotoxin 1 is an important candidate for the study of pain, pain treatment, and development of analgesics. It is also an interesting toxin in order to decipher the involvement of Nav1.7 in cellular excitability and pain3,4.

    Target NaV channels
    Peptide Content: 100%
    Last update: 20/11/2022

    Phlotoxin 1 ((#STP-800) is a highly pure, synthetic and biologically active peptide toxin.

    For research purposes only, not for human use
    Shipping and Ordering information