Slotoxin

K+ channel toxin α-KTx 1.11, SloTx
A Novel Blocker of KCa1.1 Channel
Cat #: RTS-410
Alternative Name K+ channel toxin α-KTx 1.11, SloTx
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Centruroides noxius (Mexican scorpion).
    Source Recombinant, E. coli
    MW: 4086 Da.
    Purity: >98% (HPLC)
    Effective concentration 10-100 nM.
    Sequence TFIDVDCTVSKECWAPCKAAFGVDRGKCMGKKCKCYV.
    Modifications Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35.
    Molecular formula C177H281N47O50S7.
    CAS No.: 401470-29-9.
    Activity Slotoxin inhibits the Maxi K+ (BKCa or mSlo, KCNMA1, KCa1.1) channels1. Slotoxin differentially blocks channels formed by the α1 subunit alone and channels formed by the α1 combined with auxiliary β subunits.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
      • Alomone Labs Slotoxin inhibits mSlo channels heterologously expressed in Xenopus oocytes.
        Left: Time course of current amplitude changes upon application of 100 nM Slotoxin (#RTS-410), (bars represent the time of toxin perfusion). Right: An example of current response to 100 ms depolarization to +20 mV (from a holding potential of -100 mV) before (red) and during (black) perfusion of 100 nM Slotoxin.
      • Native Slotoxin was originally isolated from Centruroides noxius scorpion venom.

        Native Slotoxin blocks the Maxi K+ (BKCa or slo, KCNMA1, KCa1.1) channels.1

        Slotoxin blocks differentially channels formed by the α1 subunit alone and channels formed by the α1 combined with auxiliary β subunits. In Xenopus oocytes expressing hSlo (α1 alone), Kd was calculated to be 1.5 nM and the block is complete and reversible. With the additional co-expression of either the β1 or β4 subunits, the block become irreversible or causes the channel to be almost insensitive to the toxin, respectively.1

    Target KCa1.1 K+ channels
    Net Peptide Content: 100%
    Last update: 10/03/2019

    Slotoxin (#RTS-410) is a highly pure, recombinant, and biologically active peptide toxin.

    For research purposes only, not for human use