Overview
Cat #:
STS-410
Alternative Name K+ channel toxin α-KTx 1.11, SloTx
Lyophilized Powder yes
Origin Synthetic peptide.
MW: 4086 Da
Purity: >98% (HPLC)
Form Lyophilized powder.
Effective concentration 10-100 nM.
Sequence TFIDVDCTVSKECWAPCKAAFGVDRGKCMGKKCKCYV.
Modifications Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35.
Structure
Molecular formula C177H281N47O50S7.
CAS No.: 401470-29-9
Activity Slotoxin inhibits the Maxi K+ (BKCa or mSlo, KCNMA1, KCa1.1) channels1. Slotoxin differentially blocks channels formed by the α1 subunit alone and channels formed by the α1 combined with auxiliary β subunits.
References-Activity
- Garcia-Valdes, J. et al. (1998) FEBS. Lett. 505, 369.
Accession number
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to one week at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs Slotoxin inhibits the current of Kca1.1 (mSlo) channels expressed in Xenopus oocytes.A. Representative time course of Kca1.1 current inhibition by 50 nM Slotoxin (#STS-410). Membrane potential was held at -100 mV, current was elicited by a 150 ms voltage ramp to +100 mV every 10 sec, and reversibly inhibited by Slotoxin (as indicated in green). B. Superimposed traces of Kca1.1 current before (black) and after application of 50 nM Slotoxin (green) taken from the recording in A.
Scientific background
Native Slotoxin was originally isolated from Centruroides noxius scorpion venom.
Native Slotoxin blocks the Maxi K+ (BKCa or slo, KCNMA1, KCa1.1) channels.1
Slotoxin blocks differentially channels formed by the α1 subunit alone and channels formed by the α1 combined with auxiliary β subunits. In Xenopus oocytes expressing hSlo (α1 alone), Kd was calculated to be 1.5 nM and the block is complete and reversible. With the additional co-expression of either the β1 or β4 subunits, the block become irreversible or causes the channel to be almost insensitive to the toxin, respectively.1
Target KCa1.1 K+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024
Specifications
Citations
Citations