Free shipping starts now, no minimum, no coupons required!

Certificate of Analysis

SNARE Complex Antibody Explorer Kit

A Screening Package of SNARE Complex Antibodies Economically Priced

Cat #: AK-525
Size: 8 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-Alpha-Synuclein Antibody Cat #: APZ-035

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: M, R
Immunogen
Peptide (C)KDQMGKGEEGYPQE, corresponding to amino acid residues 97-110 of rat α-synuclein (Accession P37377). Intracellular, C-terminus.
Homology
Mouse – identical; human – 11/14 amino acid residues identical.

Anti-SNAP-25 Antibody Cat #: ANR-001

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARV VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG, corresponding to the full-length of rat SNAP-25 (Accession P60881). Cytoplasmic.
Homology
Human, mouse - identical.

Anti-Synaptotagmin-1 (SYT1) Antibody Cat #: ANR-003

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
Peptide MVSASHPEALAAPVTTVAT(C), corresponding to amino acid residues 1-19 of rat synaptotagmin 1 (Accession P21107). Intravesicular, N-terminus.
Homology
Mouse - 18/19 amino acid residues identical; human, bovine - 17/20 amino acid residues identical; chicken - 15/19 amino acid residues identical.

Anti-Syntaxin 1 Antibody Cat #: ANR-002

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
GST fusion protein with the sequence MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKK, corresponding to amino acid residues 1-265 of rat syntaxin 1A (Accession P32851). Intracellular, N-terminus.
Homology
Human, mouse- 264/265 amino acid residues identical.

Anti-Syntaxin 2 Antibody Cat #: ANR-008

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: R
Immunogen
Peptide RDRLPDLTACRKSDDGDN, corresponding to amino acid residues 2-19 of rat Syntaxin 2 (Accession P50279). N-terminus.
Homology
Human - 16/17 amino acid residues identical; mouse - 15/17 amino acid residues identical.

Anti-Syntaxin 3 Antibody Cat #: ANR-005

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, WB Reactivity: H, M, R
Immunogen
Peptide KDRLEQLKAKQLTQD(C), corresponding to amino acid residues 2-16 of rat syntaxin 3 (Accession Q08849). Cytoplasmic, N-terminus.
Homology
Mouse, human - identical.

Anti-Syntaxin 4 Antibody Cat #: ANR-004

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IH, IP, WB Reactivity: M, R
Immunogen
Peptide RDRTHELRQGDNISDDEDEVRV(C), corresponding to residues 2-23 of rat syntaxin 4 (Accession Q08850). Intracellular, N-terminus.
Homology
Mouse - identical; human - 17/22 amino acid residues identical.

Anti-VAMP-2 Antibody Cat #: ANR-007

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: M, R
Immunogen
GST fusion protein with the sequence SATAATVPPAAPAGEGGPPAPPPNLT, corresponding to amino acid residues 2-27 of rat VAMP2 (Accession P63045). Cytoplasmic, N-terminus.
Homology
Human, bovine, Macaca mulata - 25/26 amino acid residues identical.

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For research purposes only, not for human use
Shipping and Ordering information