Free shipping starts now, no minimum, no coupons required!

SpTx-1

A human KATP (Kir6.2/SUR1) potassium channel blocker

Cat #: STS-800
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Scolopendra polymorpha
    Source Synthetic peptide
    MW: 6366 Da
    Purity: >98% (HPLC)
    Form Lyophilized powder
    Effective concentration 15 - 50 nM
    Sequence ADLIKKKLPFRTRSKFPRKSECVQDCAKAFTNGNKDKIKDVKSEFFSCYCWYEA-OH
    Modifications Disulfide bonds location - The exact location of the disulfide bridges is currently unknown.
    Structure
    Molecular formula C286H441N77O80S4
    Activity SpTx-1 inhibits hKATP channels with a Kd of 15 nM by blocking the hKir6.2 pore1.
    References-Activity
    1. Ramu, Y. et al. (2018) J. Gen. Physiol., 150, 969.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Soluble in water. Centrifuge all products before use (10000 x, g 5 min). It is recommended to prepare fresh solutions in working buffers before use, or aliquot stock solutions reconstituted in distilled water and keep at -20°C. Upon use, dilute the stock solution in the desired working buffer. Prevent repeated thawing and freezing cycles.
    Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C.
    Our bioassay
    • Alomone Labs SpTx-1 inhibits Kir6.2/SUR1 channels stably expressed in HEK-293 cells.
      Alomone Labs SpTx-1 inhibits Kir6.2/SUR1 channels stably expressed in HEK-293 cells.
      A. The percent inhibition of KATP channels (comprising Kir6.2 + SUR1 subunits) stably expressed in HEK-293 cells, in the presence of different concentrations of SpTx-1 (#STS-670). The KATP channels were recorded using the whole cell patch clamp technique. An IC50 value of 23.6 nM was found for SpTx-1 in this experiment.
      B. A representative cell recording showing the KATP (Kir6.2 + SUR1) currents (I in nA) under control conditions (without toxin) compared to conditions with different concentrations of SpTx-1.
    References - Scientific background
    1. Ramu, Y. et al.  (2019) Nature Sci. Rep., 9, 14088.
    2. Seino, S. (1999) Annu. Rev. Physiol., 61, 337.
    3. Zhao, G. et al. (2020) J. Clin. Invest., 130, 1112.
    4. Zhao, S. et al. (2021) Brain Res. Bull., 169, 1.
    Scientific background

    SpTx-1 is a 54 amino acid peptidyl toxin originally isolated from the venom of the centipede, Scolopendra polymorpha. This toxin blocks the adenosine triphosphate (ATP)-sensitive K+ (KATP) channel with a Kd value of 15 nM, primarily by targeting of the pore-forming inwardly rectifying K+ channel (Kir) 6.2 subunit that is coexpressed with the regulatory sulfonylurea receptor 1 (SUR1)1.

    The KATP channel is a hetero-octameric protein complex, consisting of four Kir6.x pore subunits and four regulatory ATP-binding cassette SURx subunits. The KATP channels are present in many different tissues such as skeletal muscle, smooth muscle, pancreatic β-cells, cardiomyocytes, and brain. Since these channels are responsible for linking cell metabolism and membrane potential, they are crucial for the regulation of different cellular pathways2. Kir6.x or SUR mutations result in KATP channelopathies, which reflect the physiological roles of these channels, including but not limited to insulin secretion, cardiac protection, neuroprotection, and blood flow regulation3,4.

    Target hKATP inhibitor, Kir6.2
    Peptide Content: 100%
    Last update: 29/08/2021

    SpTx-1 (#STS-800) is a highly pure, synthetic, and biologically active toxin.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Shipping and Ordering information