Free shipping starts now, no minimum, no coupons required!

SsdTx3

Kappa-scoloptoxin (15)-Ssd3a, Kappa-SLPTX(15)-Ssd3, Toxin SSD893, k- SLPTX(15)-Ssd3

A human KATP (Kir6.2/SUR1) potassium channel blocker

Cat #: STS-670
Alternative Name Kappa-scoloptoxin (15)-Ssd3a, Kappa-SLPTX(15)-Ssd3, Toxin SSD893, k- SLPTX(15)-Ssd3
Lyophilized Powder yes
  • Bioassay Tested
  • Origin Scolopendra subspinipes dehaani (Thai centipede)
    Source Synthetic
    MW: 6101 Da
    Purity: >98%
    Form Lyophilized powder
    Effective concentration 100-500 nM
    Sequence EVIRKEIPYKKRKFPYKSECRKACATAFTGGDESRIKDVKPGFFKCSCYYSSG
    Structure
    • The exact location of the disulfide bridges is currently unknown.

      The exact location of the disulfide bridges is currently unknown.
    Molecular formula C273H422N74O77S4
    Activity SsdTx3 inhibits hKATP channels with a Kd of <300 nM by blocking the hKir6.2 pore1.
    References-Activity
    1. Ramu, Y. and Lu, Z. Nature Sci. Rep. (2019) 9, 14088.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Soluble in DDW.
    Centrifuge all products before use (10000 x g 5 min).
    Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing.
    Our bioassay
    • Alomone Labs SsdTx3 inhibits Kir6.1/SUR1 channels stably expressed in HEK-293 cells.
      Alomone Labs SsdTx3 inhibits Kir6.1/SUR1 channels stably expressed in HEK-293 cells.
      A. The percent inhibition of KATP channels (comprising Kir6.1 + SUR1 subunits) stably expressed in HEK-293 cells, in the presence of different concentrations of SsdTx3 (#STS-670). The KATP channels were recorded using the whole cell patch clamp technique. An IC50 value of 376 nM was found for Ssd3a in this experiment.
      B. A representative cell recording showing the KATP (Kir6.1 + SUR1) currents (I in nA) under control conditions (without toxin) compared to conditions with different concentrations of SsdTx3. The data indicated that the toxin-mediated inhibition was reversible.
    References - Scientific background
    1. Ramu, Y. and Lu, Z. Nature Sci. Rep. (2019) 9, 14088.
    2. Seino, S. Annu. Rev. Physiol. (1999) 61, 337.
    Scientific background

    SsdTx3 (kappa-scoloptoxin(15)-Ssd3a) is a toxin isolated from the venom of the centipede Scolopendra subspinipes dehaani, a species that inhabits Asia. SsdTx3 was found to be an inhibitor of hKATP channels by blocking the hKir6.2 pore co-expressed with hSUR1. Dose-Response curve of the hKATP channels inhibition revealed that SsdTx3 inhibits hKATP channels with a Kd values of 278nM1.

    SsdTx belongs to a family of five proteins, discovered so far from a multiple centipede species, that target hKATP channel by blocking the hKir6.2 pore. They have conserved features of four cysteine residues and a P-P segment that contains positively charged residues important for blocking the K+ pore1.

    ATP-sensitive K+ ion channels (KATP channels) can be found in many different tissues such as pancreatic β-cells, carried myocytes, skeletal muscle, smooth muscle and brain. KATP channels are responsible for linking between the cell metabolism and the membrane potential and therefore they are critical for the regulation of different cellular pathways2.

    Target KATP inhibitor
    Net Peptide Content: 100%

    Widget not in any sidebars
    Last update: 02/03/2021

    SsdTx3 (#STS-670) is a highly pure, synthetic, and biologically active toxin.

    For research purposes only, not for human use

    Applications

    Specifications

    Scientific Background

    Citations

    Citations
    Shipping and Ordering information