Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 
Alomone Labs Alomone Labs

Order Summary

Home

main

    • column
      • Ion Channels
    • column
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
    • column
      • Cell Imaging Tools
      • Research Areas
  • Home
  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Controls
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
      • Kits & Packs
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Services
    • column
      • Custom Services
      • Online Quotes New
      • Ordering & Shipping
  • Resources
    • column
      • Protocols
      • FAQs and Troubleshooting
      • Citations Search Tool
    • column
      • Blog
      • Articles
      • Download Protocol Book
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
      • Subscribe – Printed Magazines
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Certificate of Analysis

Stromatoxin-1

κ-Theraphotoxin-Sc1a, κ-TRTX-Sc1a, ScTx1

A Potent Blocker of KV2.1, KV2.2, KV4.2 and KV9.3 Channels

Cat #: STS-350
Alternative Name κ-Theraphotoxin-Sc1a, κ-TRTX-Sc1a, ScTx1
Lyophilized Powder yes
  • Bioassay Tested

    Every lot is tried & tested in a relevant biological assay.
    Our Bioassay

  • Origin Synthetic peptide
    MW: 3792 Da
    Purity: >98% (HPLC)
    Effective concentration 1.2-670 nM
    Sequence DCTRMFGACRRDSDCCPHLGCKPTSKYCAWDGTI
    Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys28, Ile34 - C-terminal amidation
    Structure
    Molecular formula C156H237N49O48S7
    Activity Stromatoxin-1 is a potent inhibitor of voltage-gated K+ channels. It inhibits delayed KV2.1, KV2.1/9.3, KV2.2, and transient KV4.2 channels1,2.
    References-Activity
    1. Escoubas, P. et al. (2002) Mol. pharmacol. 62, 48.
    2. Shiau, Y.S. et al. (2003) Chem. Res. Toxiol. 16, 1217.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all products preparations before use (1000 X g 5 min).
    Storage of solutions Up to one week at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Stromatoxin-1 inhibits KV2.1 channels heterologously expressed in Xenopus oocytes.
      Alomone Labs Stromatoxin-1 inhibits KV2.1 channels heterologously expressed in Xenopus oocytes.
      Left: Time course of KV2.1 current amplitude before and during application of 100 nM Stromatoxin-1 (#STS-350). The periods of Stromatoxin-1 perfusion is indicated by the horizontal bar.
      Right: Stromatoxin-1 dose-dependent inhibition of KV2.1 current amplitude.
    Scientific background

    Stromatoxin-1 is a 34 amino acid peptidyl toxin originally isolated from Stromatopelma calceatum tarantula1. Structurally, Stromatoxin-1 belongs to the scaffold of structural inhibitor cysteine knot peptide family, which were shown to function as gating modifiers2.

    Stromatoxin-1 selectively inhibits KV2.1, KV2.1/9.3, and KV4.2 channel currents (IC50 of 12.7 nM, 7.2 nM and 1.2 nM respectively), and is the first high-affinity voltage gating modifier inhibitor of the KV2.2 channel subtype (IC50, 21.4 nM) to be discovered1.

    Target Various KV channels
    Peptide Content: 100%
    Lyophilized Powder
    Back to product pageSDSNew Generate a Quote
    Last update: 06/11/2022

    See Related Products

    For research purposes only, not for human use

    Specifications

    Citations

    Citations

    Applications

    Scientific Background

    Shipping and Ordering information
      Back to product pageSDSNew Generate a Quote

      Free International Shipping

      Products are lyophilized and ship at room temperature - FREE OF CHARGE.

      We ship worldwide within 24 hours of our next business day.

      For more country-specific shipping and contact information see Ordering & Shipping.


      Free Sample Program

      Not sure whether the product fits your experimental setup?

      Try it first!


      Alomone Guarantee

      We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

      Alomone Guarantee information

      Need Help With This Product?

      Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

      Call us at
      +972 2587 2202 or Email Us

      Contact Us

      © 2023 Alomone Labs. All Rights Reserved.

      Terms of Service Privacy Policy
      Scroll to top

      Bulk / Customized order