Tf2 Toxin

Tf2 scorpion toxin
A Specific NaV1.3 Channel Opener
    Cat #: STT-050
    Alternative Name Tf2 scorpion toxin
  • Lyophilized Powder
  • Bioassay Tested
  • Origin Synthetic peptide
    MW: 6954 Da.
    Purity: >98% (HPLC)
    Form Lyophilized powder.
    Effective concentration 1 µM.
    Sequence KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC.
    Modifications Disulfide bonds between Cys11- Cys62, Cys15- Cys38, Cys23- Cys43, Cys27- Cys45. C-terminal amidation at Cys62.
      • Tf2 Toxin
    Molecular formula C309H438N80O87S9.
    Activity Tf2 Toxin is a specific NaV1.3 channel opener1.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g for 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
      • Tf2 Toxin
        Alomone Labs Tf2 Toxin affects the activation of human NaV1.3 channels expressed in Xenopus oocytes.
        A. Representative traces of NaV1.3 channel currents before (black) and after (green) the application of 1 µM Tf2 Toxin (#STT-050). Tf2 Toxin caused a significant current at a voltage that does not normally activate the channels. Membrane potential was held at -100 mV, and a voltage step to -30 mV was applied every 10 sec. B. Normalized I-V curve. 1 µM Tf2 Toxin (green) shifts the activation of NaV1.3 channels to more negative voltages compared to control (black).
    References - Scientific background
    • 1. Camargos, T.S. et al. (2015) PLoS ONE 10, e0128578.
    • 2. Yang, L. et al. (2016) Int. J. Mol. Sci. 17, 9.
    • 3. Su, S. et al. (2017) Front. Mol. Neurosci. 10, 126.
      • Tf2 Toxin is a β-scorpion peptide toxin originally isolated from the venom of the Brazilian scorpion Tityus fasciolatus. Tf2 Toxin acts as a specific NaV1.3 channel opener. It shifts human NaV1.3 channel voltage activation towards negative values and effectively opens the channel at resting membrane potentials1.

        NaV channels are integral membrane proteins that allow movement of Na+ ions across cellular membranes. in response to local membrane depolarization these channels mediate the influx of Na+ ions2,3.

        NaV1.3 channel is encoded by the Scn3A gene and is expressed in peripheral nociceptive neurons of dorsal root ganglion, in the developing nervous system and in pancreatic islet cells2. Abnormalities in Scn3A gene expression are associated with epilepsy, mental retardation, autism, and neuropathic pain3.

    Target NaV1.3 channel
    Net Peptide Content: 100%
    Last update: 20/08/2019

    Tf2 Toxin (#STT-050) is a highly pure, synthetic, and biologically active peptide toxin.

    For research purposes only, not for human use