Free shipping starts now, no minimum, no coupons required!

Accessibility

Accessibility Statement

 
Introduction
The internet today constitutes the largest database of free information for all users, including users with disabilities. As such, we place great emphasis on providing equal opportunity for people with disabilities to be able to use the information on our website and enjoy a better browsing experience. 
We aim to ensure that digital services are accessible to people with disabilities, and therefore we have invested large resources in order to simplify the use of the website for people with disabilities as much as possible, out of the belief that every person deserves the right to live with equality, dignity, convenience, and independence. 
 
Using the website accessibility program
This website is run by the accessibility program of the "Accessible with a Click" company and is run via a designated accessibility server. The program allows the website to follow the guidelines for internet content accessibility WCAG 2.0 to level AA. The program is subject to the conditions of use of the manufacturer. Warrantee of use applies to the website owners and/or their representative, including the content displayed in the website, as subject to the conditions of use. 
 
How does accessibility work on the website?

The website has an accessibility menu. Clicking on the menu opens accessibility buttons. After choosing a subject in the menu, waiting time is necessary for the page to upload. 

What is in the menu?

 

✓ Ability to navigate with the keyboard
✓ Increasing and decreasing the website fonts
✓ Changing color contrast based on dark backgrounds
✓ Changing color contrast based on light backgrounds
✓ Adapting the website to color blind people
✓ Underlining links throughout the website

 

Clarification

Despite our efforts to enable website browsing for all the website pages, there may be website pages that haven't been made accessible yet or may lack a suitable technical solution.
We are continuing our efforts to enhance the accessibility of the website as much as possible, out of our moral obligation to enable the use of the website for the population as a whole, including people with disabilities. 
Alomone Labs Alomone Labs

Order Summary

Home

main

    • column
      • Ion Channels
    • column
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
    • column
      • Cell Imaging Tools
      • Research Areas
  • Home
  • Products
    • column
      • New Products
      • All Products
      • Research Areas
      • Select Targets
    • column
      • Ion Channels
      • G-Protein Coupled Receptors
      • Transporters, Exchangers and Pumps
      • Kits & Packs
    • column
      • Neurotrophic Factors and Receptors
      • Neural Signaling
      • Cell Imaging Tools
    • column
      • Guinea Pig Polyclonal Antibodies
      • Multiplex Staining Products
      • Live Cell Imaging Products
      • Live Cell Flow Cytometry Products
  • Services
    • Custom Services
  • Support
    • column
      • Protocols
      • FAQs and Troubleshooting
      • Ordering & Shipping
    • column
      • Free Sample Program
      • Online Quotes New
      • Alomone Guarantee
  • Resources
    • column
      • Blog
      • Articles
      • Citations Search Tool
    • column
      • Live Cell Imaging Catalog
      • Multiplex Immunostaining Guide
  • About
    • column
      • About Alomone Labs
      • Why Alomone Labs?
  • Contact
    • column
      • Contact Us
      • Subscribe – Newsletters and Email Updates
      • Subscribe – Printed Magazines
Return to Content
Home › Products › Ion Channels › K+ Channels › Voltage-Gated K+ Channels › Blockers

Certificate of Analysis

Urotoxin

Potassium channel toxin alpha-KTx 6.21

A Super Potent Blocker of KV1.2 Channel

Cat #: STU-200
Alternative Name Potassium channel toxin alpha-KTx 6.21
Lyophilized Powder yes
  • Bioassay Tested

    Every lot is tried & tested in a relevant biological assay.
    Our Bioassay

  • Origin Synthetic peptide
    MW: 4012.7 Da
    Purity: >98% (HPLC)
    Form Lyophilized powder.
    Effective concentration 50 pM – 1 nM.
    Sequence GDIKCSGTRQCWGPCKKQTTCTNSKCMNGKCKCYGCV.
    Modifications Disulfide bonds between Cys5-Cys26, Cys11-Cys31, Cys15-Cys33 and Cys21-Cys36. Val37 - C-terminal amidation.
    Structure
    Molecular formula C161H260N52O50S9.
    Activity Urotoxin is a potent KV1.2 channel blocker. The toxin also blocks KV1.1, KV.3 and KCa3.1 channels.
    References-Activity
    1. Luna-Ramirez K. et al. (2014) Mol. Pharmacol. 86, 28.
    Accession number P0DL37.
    Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
    Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
    Storage of solutions Up to two weeks at 4°C or three months at -20°C.
    Our bioassay
    • Alomone Labs Urotoxin blocks KV1.2 channels expressed in Xenopus oocytes.
      Alomone Labs Urotoxin blocks KV1.2 channels expressed in Xenopus oocytes.
      A. Representative time course of Urotoxin (#STU-200) inhibition of KV1.2 current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +40 mV every 10 sec, and significantly inhibited by 0.1 nM Urotoxin (green). B. Superimposed traces of KV1.2 current after application of control (black) and of 0.1 nM Urotoxin (green), taken from the recording in A.
    Scientific background

    Urotoxin is a peptide toxin originally isolated from Urodacus yaschenkoi Australian Scorpion venom. Urotoxin is an extremely potent blocker of human voltage-gated potassium channel KV1.2 channels with IC50 values of 160 pM. However, it also displays activity towards KV1.1, KV1.3 and KCa3.1 with IC50 values of 253 nM, 91 nM and 70 nM respectively1.

    Potassium channels are membrane proteins found in excitable and nonexcitable cells. KV1.2 channel plays an important role in the maintenance of resting membrane potential and the regulation of the cellular excitability of neurons1,2.

    Target KV1.2, KV1.1, KV1.3, KCa3.1 channels
    Peptide Content: 100%
    Lyophilized Powder
    Back to product pageSDSNew Generate a Quote
    Last update: 02/01/2022

    See Related Products

    For research purposes only, not for human use

    Specifications

    Citations

    Citations

    Applications

    Scientific Background

    Shipping and Ordering information
      Back to product pageSDSNew Generate a Quote

      Resources

      • KV1.3 Channels

      Free International Shipping

      Products are lyophilized and ship at room temperature - FREE OF CHARGE.

      We ship worldwide within 24 hours of our next business day.

      For more country-specific shipping and contact information see Ordering & Shipping.


      Free Sample Program

      Not sure whether the product fits your experimental setup?

      Try it first!


      Alomone Guarantee

      We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

      Alomone Guarantee information

      Resources

      • KV1.3 Channels

      Need Help With This Product?

      Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.

      Call us at
      +972 2587 2202 or Email Us

      Contact Us

      Get a free trial sample

      Read more about our Free Sample Program

      © 2022 Alomone Labs. All Rights Reserved.

      Terms of Service Privacy Policy
      Scroll to top

      Bulk / Customized order