- GST fusion protein with the sequence GSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRK, corresponding to amino acid residues 227-353 of human M1 (Accession P11229). 3rd intracellular loop.
- Western blot analysis of rat brain membranes:1. Anti-CHRM1 Antibody (#AMR-001), (1:200).
2. Anti-CHRM1 Antibody, preincubated with CHRM1 Blocking Peptide (#BLP-MR001).
- Expression of Muscarinic acetylcholine receptor M1 in rat striatumImmunohistochemical staining of rat striatum (ST) using Anti-CHRM1 Antibody (#AMR-001). A. M1 mAChR appears in the striatum (green). B. Staining of interneurons with mouse anti-parvalbumin (PV, red). C. Confocal merge of M1 mAChR and PV demonstrates localization of PV expressing neurons in the striatal matrix; not in striatal patches (P).
- Expression of Muscarinic acetylcholine receptor M1 in mouse striatumImmunohistochemical staining of mouse striatum (ST) using Anti-CHRM1 Antibody (#AMR-001). A. M1 mAChR appears in the striatum (green). B. Staining of interneurons with mouse anti-parvalbumin (PV, red). C. Confocal merge of M1 mAChR and PV demonstrates localization of PV expressing neurons in the striatal matrix; not in striatal patches (P).
- Human colon (1:50) (Harrington, A.M. et al. (2010) Neurogastroenterol. Motil. 22, 999.).
- Transfected CHO cells (Kovoor, A. et al. (2005) J. Neurosci. 25, 2157.).
- Felder, C.C. et al. (2000) J. Med. Chem. 43, 4333.
- Forsythe, S.M. et al. (2002) Am. J. Respir. Cell. Mol. Biol. 26, 298.
- Ferreira, A.R. et al. (2003) Pharmacol. Biochem. Behav. 74, 411.
- Van der Zee, E.A. and Luiten, P.G. (1999) Prog. Neurol. 58, 409.
- Levey, A.I. et al. (1991) J. Neurosci. 11, 3218.
- Wang, J. et al. (2000) Am. J. Physiol. Gastrointest. Liver Physiol. 279, G1059.
- Budd, S.C. et al. (2003) J. Biol. Chem. 278, 19565.
The action of the neurotransmitter acetylcholine (ACh) is mediated through two types of receptors, the ionotrophic nicotinic receptors and the metabotrophic muscarinic receptors. The muscarinic receptors belong to the superfamily of 7-TM G-protein-coupled receptors. Five subtypes of muscarinic receptors have been cloned and named M1-M5.1-2
The muscarinic receptors are widely distributed throughout the body, but are predominantly expressed within the parasympathetic nervous system and exert both excitatory and inhibitory control over central and peripheral tissues.1-2
Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing and motor control.1 They also participate in learning and memory processing.3-4 The M1 receptors are the most abundant muscarinic subtype in the cortex and striatum. M1 receptors were also localized in the myenteric plexus where they function as autoreceptors to enhance the release of ACh from the nerves.5-6
The M1, M3 and M5 receptors, which are coupled to Gq/11 proteins, can protect cells from undergoing apoptosis induced by DNA damage. The signaling mechanism that mediates this anti-apoptotic response is still poorly understood. However, it was recently reported that a poly-basic motif in the C-terminus tail of the M1, M3 and M5 receptors is an essential element for the anti-apoptotic response of those receptors.7
Application key:
Species reactivity key:
Alomone Labs is pleased to offer a highly specific antibody directed against the 3rd intracellular loop of the human M1 muscarinic receptor. Anti-CHRM1 Antibody (#AMR-001) can be used in western blot analysis, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize M1 from human, mouse and rat samples.
Applications
Citations
- Mouse liver and brain lysates (1:1000). Tested in M1R-/- mice.
Urrunaga, N.H. et al. (2015) Free Radic. Biol. Med. 78, 66.
- Mouse liver and brain lysates (1:1000). Tested in M1R-/- mice.
Urrunaga, N.H. et al. (2015) Free Radic. Biol. Med. 78, 66.
- Harrington, A.M. et al. (2010) Neurogastroenterol. Motil. 22, 999.
- Kovoor, A. et al. (2005) J. Neurosci. 25, 2157.
Specifications
Scientific Background
Related Products
Antibodies
Pharmacological tools
Explorer kits & Research packs
Resources
Need Help With This Product?
Our reagent specialists are here to help you find the best product for your application. Please call or email us and we will be happy to help you find the right product for the job.
Call us at
+972 2587 2202 or Email Us